KEGG   Deinococcus peraridilitoris: Deipe_3614Help
Entry
Deipe_3614        CDS       T02381                                 

Definition
arginase family hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dpd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3640450..3641367)
Genome map
AA seq 305 aa AA seqDB search
MAHLPFSGIASFARAPIVESGGEWRSDVAVLGVPFDIALGYRPGARFAPRAIREASLRYA
LTEEGFYDLESGRTRLAGLRLADAGDVELPSLETELAHARIEEAARQLRARCSLPVFLGG
DHSVTYPLLRAFDDVPDLHVVQLDAHLDFTDLRNDTRLSNSSPFRRACEDLPNLTHITTL
GLRGLRFDREAVDAARSRGHQLVTMRRLTENLDEVLAVLPTEKAVYLSLDVDAFDPSVLP
GTSSPEPDGLTYGLAMGLIREVVRRNHLLAYDVVELAPNLDSSGRSSLLAARLIMETLVE
ALDAR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatctccccttctccggcatcgcctcctttgcgcgggcgcccatcgttgaaagc
gggggcgagtggcgctcggacgtggccgtgctgggcgtgccgtttgacatcgccctcggt
taccggcccggagcgcgctttgctccccgggcgatccgggaagccagcctgcgctacgcc
ctgaccgaagaaggcttctacgacctcgaaagtggccgcacacgcctggcgggcctgcgc
ctggccgacgccggcgacgtggaattgcccagcctggaaaccgaactcgcgcacgcccgc
atcgaggaagcggcccggcagctccgcgcgcgctgcagcctcccggtgtttctgggcggc
gaccacagcgtgacgtacccgctgctgcgcgcctttgacgacgtgccggatctgcacgtg
gtgcagctcgacgcgcacctcgacttcaccgacctgcgcaacgacacccgcctcagcaat
tccagcccctttcgccgtgcctgcgaggacctgcccaacctgacccacatcacgaccctg
ggtctgcgcgggctgcgctttgaccgggaggcggtcgacgctgcgcggtcgcgcgggcac
cagctggtcacgatgcgccgcctgaccgagaacctcgacgaggtgctcgccgtcttgccc
acggaaaaggcagtctacctctcgctcgatgtggacgccttcgacccgagcgtgctgccc
ggaaccagcagccccgagccggacgggctgacctacggtctggccatggggctcattcgt
gaggtcgtgcggcgcaaccacctgctggcgtatgacgttgtggaactcgcacccaacctc
gactcgtcggggcgcagcagcctgctcgccgcgcgcctgatcatggaaaccctggtcgag
gccctcgatgcacgctga

DBGET integrated database retrieval system