KEGG   Deinococcus peraridilitoris: Deipe_3736Help
Entry
Deipe_3736        CDS       T02381                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:dpd01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dpd00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dpd00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:dpd00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3792686..3793831
Genome map
AA seq 381 aa AA seqDB search
MKLHEYQGKELLRRFGVNVQEGKVAYTPDEVRSIAQEFGQSVVVKAQVHVGGRGKAGGVK
FSPDPEKAYENGQKILGMDIKGLTVKKVLVTKAVDIDAGTEYYVGMIVDRNVQSYTLMAS
AEGGMEIEEVAAENPDAIIRFRVDPTTGLRPFEAREVVLRAGFKGNLNKIADMMVKMSEA
ALKMDAVLVEINPLFVDESGIPLALDTKFEIDDNAMYRHKDLADWRELEAEHPLEIEASN
YGFAYVKLDGHVGVLGNGAGIVMTSLDVVNRAGAKPANFLDIGGGARADIVYNAVKLVQK
DSDVKSIFVNIFGGITRADEVAKGVIQALQEGILTKPVRMRIAGTAEEEAKALLAEVNSP
LIQMYPDMFQAAEAAAQEANK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactccacgagtatcaaggcaaggaattgctgcggcgtttcggcgtgaacgtgcag
gaaggcaaagtggcctacacgcccgatgaggtgcgctcgatcgcgcaggaattcggtcag
tcggtcgtcgtgaaagcgcaggttcacgtgggcggacgcggcaaggcaggcggcgtgaag
ttcagccccgatcccgaaaaagcctatgaaaacggccagaagattctgggcatggacatc
aagggcctgacggtcaagaaggtgttggtgaccaaggcggtcgacatcgacgcgggcacc
gagtactacgtcggcatgatcgtggaccgcaacgtgcagtcttataccctgatggcctcc
gccgagggcggcatggaaatcgaggaagtcgccgccgagaatcctgacgcgatcatccgc
ttccgggtcgatcccaccaccggtctgcgtcccttcgaggctcgcgaggtggtactgcgc
gcgggcttcaagggcaacctcaacaagatcgccgacatgatggtcaagatgagcgaagca
gccctcaagatggacgccgtgctggtcgagatcaatccgctgttcgtggacgagtcgggc
atccccctggcgctcgacaccaagttcgagatcgacgacaacgccatgtaccgtcacaag
gacctcgccgactggcgtgagctcgaagccgagcatccgctggaaatcgaggccagcaac
tatggcttcgcgtacgtcaagctcgacggtcacgtgggcgtgctgggcaacggcgcgggc
atcgtgatgacctcgctggatgtcgtgaaccgcgcgggcgccaaacccgccaacttcctc
gacatcggcggcggcgcccgcgcggacatcgtgtacaacgccgtgaagctggtccagaag
gacagcgacgtgaaaagcatcttcgtgaacatcttcggcggcatcacccgcgccgacgag
gtcgccaagggcgtcattcaggcgctgcaggaaggaattcttaccaagccggtgcgcatg
cgcatcgccggcacggccgaggaggaagccaaggcgctgctggccgaagtcaacagcccg
ctcatccagatgtatccggatatgttccaggccgccgaggccgccgcgcaggaggcgaac
aagtaa

DBGET integrated database retrieval system