KEGG   Deinococcus peraridilitoris: Deipe_3736Help
Entry
Deipe_3736        CDS       T02381                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deipe_3736
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deipe_3736
   00640 Propanoate metabolism
    Deipe_3736
   00660 C5-Branched dibasic acid metabolism
    Deipe_3736
Enzymes [BR:dpd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Deipe_3736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3792686..3793831
Genome map
AA seq 381 aa AA seqDB search
MKLHEYQGKELLRRFGVNVQEGKVAYTPDEVRSIAQEFGQSVVVKAQVHVGGRGKAGGVK
FSPDPEKAYENGQKILGMDIKGLTVKKVLVTKAVDIDAGTEYYVGMIVDRNVQSYTLMAS
AEGGMEIEEVAAENPDAIIRFRVDPTTGLRPFEAREVVLRAGFKGNLNKIADMMVKMSEA
ALKMDAVLVEINPLFVDESGIPLALDTKFEIDDNAMYRHKDLADWRELEAEHPLEIEASN
YGFAYVKLDGHVGVLGNGAGIVMTSLDVVNRAGAKPANFLDIGGGARADIVYNAVKLVQK
DSDVKSIFVNIFGGITRADEVAKGVIQALQEGILTKPVRMRIAGTAEEEAKALLAEVNSP
LIQMYPDMFQAAEAAAQEANK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactccacgagtatcaaggcaaggaattgctgcggcgtttcggcgtgaacgtgcag
gaaggcaaagtggcctacacgcccgatgaggtgcgctcgatcgcgcaggaattcggtcag
tcggtcgtcgtgaaagcgcaggttcacgtgggcggacgcggcaaggcaggcggcgtgaag
ttcagccccgatcccgaaaaagcctatgaaaacggccagaagattctgggcatggacatc
aagggcctgacggtcaagaaggtgttggtgaccaaggcggtcgacatcgacgcgggcacc
gagtactacgtcggcatgatcgtggaccgcaacgtgcagtcttataccctgatggcctcc
gccgagggcggcatggaaatcgaggaagtcgccgccgagaatcctgacgcgatcatccgc
ttccgggtcgatcccaccaccggtctgcgtcccttcgaggctcgcgaggtggtactgcgc
gcgggcttcaagggcaacctcaacaagatcgccgacatgatggtcaagatgagcgaagca
gccctcaagatggacgccgtgctggtcgagatcaatccgctgttcgtggacgagtcgggc
atccccctggcgctcgacaccaagttcgagatcgacgacaacgccatgtaccgtcacaag
gacctcgccgactggcgtgagctcgaagccgagcatccgctggaaatcgaggccagcaac
tatggcttcgcgtacgtcaagctcgacggtcacgtgggcgtgctgggcaacggcgcgggc
atcgtgatgacctcgctggatgtcgtgaaccgcgcgggcgccaaacccgccaacttcctc
gacatcggcggcggcgcccgcgcggacatcgtgtacaacgccgtgaagctggtccagaag
gacagcgacgtgaaaagcatcttcgtgaacatcttcggcggcatcacccgcgccgacgag
gtcgccaagggcgtcattcaggcgctgcaggaaggaattcttaccaagccggtgcgcatg
cgcatcgccggcacggccgaggaggaagccaaggcgctgctggccgaagtcaacagcccg
ctcatccagatgtatccggatatgttccaggccgccgaggccgccgcgcaggaggcgaac
aagtaa

DBGET integrated database retrieval system