KEGG   Drosophila persimilis: Dper_GL10161Help
Entry
Dper_GL10161      CDS       T01063                                 

Definition
GL10161 gene product from transcript GL10161-RA
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dpe  Drosophila persimilis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dpe00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 274 aa AA seqDB search
MKPQSSEQNGSHQNGDSCAADAASVAVEAAAAAIPTAASAGAVVPVLGTKNSQQLKLEML
NLGNGNNGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPER
AAKAMLYFTKGYDQCLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYL
PCNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRG
VQKINSKTVTSTMLGVFRDDPKTREEFLNLVNSK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccaatccagtgaacaaaatggcagccatcaaaatggggattcctgcgccgcg
gatgcagcttccgttgccgttgaggctgccgccgccgcgatcccgacagcggcttccgcc
ggcgccgtcgttcctgtcctaggcaccaaaaacagtcaacagctgaaactggaaatgctc
aacttgggcaacggaaacaacggccacgagaagtgtactttccaccacgacctggagttg
gaccacaagccgcccacacgagaggcgctgctgccggacatggcgcgctcctaccgcctt
ttgctgggcggcctgggcgagaatcccgatcgccagggcctgatcaagacccccgagcga
gcggccaaggccatgctgtacttcaccaagggctacgaccaatgtctggaggatgtactg
aacggcgccgtattcgatgaggatcatgatgagatggtggttgtcaaggacattgaaatg
ttctccatgtgcgagcatcacttggtaccattctacggcaaagtgtccatcggctatttg
ccatgcaacaagatcctgggactgagcaagcttgcacgtattgtggagatcttttctcgt
cgattgcaagtgcaggagcgtctgacaaagcaaattgcagtggctgtaactcaggccgtt
cagcctgcaggcgttgccgttgtggttgaaggagtacacatgtgcatggtgatgcgaggc
gtgcagaaaatcaatagcaaaactgttacctctaccatgttgggagtgttccgggacgat
cccaagacccgcgaggaattcctgaacttagtcaatagcaaataa

DBGET integrated database retrieval system