KEGG   Drosophila persimilis: Dper_GL10214Help
Entry
Dper_GL10214      CDS       T01063                                 

Definition
(RefSeq) GL10214 gene product from transcript GL10214-RA
  KO
K20730  
beta-hexosaminidase Fdl [EC:3.2.1.52]
Organism
dpe  Drosophila persimilis
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dper_GL10214
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dper_GL10214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 655 aa AA seqDB search
MSLAVSLRRALLVLLSGAIFILTVLYWNQGGSKTQAYSEAFERPHSHKDGSSFPIPVEKF
WTYKCENDRCMRVSYHPGKTGKRVSFITCSMTCGYVNIWPAPTVKSLVSAHTTSFSVEVV
QLEQDTPHREVRKQLQLAFDCFLKDLRQIQRLDYATSPPETGESESSSWASQNDVVGAAI
SGERRPGVLESLVVKISVQKSGDVSFSLDNDESYELTAITEGHRLQVEITANSFFGARHG
LSTLQQLIWFDDEDHLLHTYVNSKVKDAPKFRYRGLMLDTSRHFFSVEAIKRTIVGMGLS
KLNRFHWHLTDAQSFPYISRNYPELAEHGAYSEGETYTEQDVREVADFAKIHGVQVIPEI
DAPAHAGNGWDWGPKRGMGELAVCINQQPWSFYCGEPPCGQLNPKNNHTYLILQRLYEEL
LQATGPTDLFHLGGDEVNLDCWAQYFNDTDLRGLWCDFMLQAMARLKLANNGVAPKYLAV
WSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHVDAWYLDCGFGSWRSTG
EAACSPYRTWQNVYKHRPWERMRLDKKRRKQVLGGEACLWTEQVDENQLDNRLWPRAGAL
GERLWSDPSDDHDLDIMAPEVFRRISLFRTRLVELGIKAEALFPKYCAQNPGECI
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtcactggccgtgtcgctgcgccgggctcttctggtgctcctctcgggcgccatcttc
atcctcaccgtgctgtactggaaccagggtggcagcaagacacaggcgtacagcgaggcg
ttcgaacgcccccacagtcacaaggacggctcctcctttcccatacccgtggagaagttt
tggacatacaaatgcgagaatgaccgatgtatgcgggtgagctatcatcctgggaagacc
ggcaaacgtgtctccttcatcacctgctcgatgacctgcgggtacgtcaacatctggcca
gcaccgaccgtcaaatcattggtcagcgcccacacaaccagcttctcggtggaggttgtg
caactggagcaggacacaccgcatcgggaggtgcggaagcagctgcagctggcctttgac
tgtttcctcaaggatctgcgccagatccagagactggactacgctaccagtccacctgag
acgggcgaaagtgaatcctcatcgtgggcatcgcagaacgatgtggtaggagccgctatt
tctggggagaggcgaccaggtgttctggagagtctggtggtgaagatcagcgtgcaaaag
tccggagatgtcagcttcagcctggataacgatgagagctatgagctgaccgccatcacg
gaaggccaccgcctgcaggtggagatcacggcgaactcgttctttggggcccgccacggc
ctctccacgctgcagcaactcatttggttcgacgacgaggatcacctgctgcacacgtac
gtcaacagcaaggtgaaggatgccccgaagttccgctatcgcggcctgatgctggatacc
tcacgccactttttctcggtggaggcgatcaagagaacgatcgtgggaatgggtctgtcc
aagctgaatcgcttccactggcatctgacagatgcgcagagctttccgtatatctcgcgc
aactatccggagctggccgagcacggggcctactcggagggcgagacgtacacggagcag
gatgtgcgcgaggtggccgactttgcaaagatccatggcgtgcaggtaataccggagatc
gatgcaccggcccatgccggcaatggctgggactgggggcccaagaggggcatgggcgag
ctggccgtgtgcatcaatcagcagccgtggagcttctactgcggagagccaccgtgcggg
cagctcaatccgaagaacaaccacacctacctcatcctgcagcgcctctacgaggagctg
cttcaggcgacggggcccacggacctctttcatctgggcggcgacgaggtgaatctcgac
tgctgggcccagtactttaacgacacggatctgcggggcttgtggtgcgacttcatgctg
caggcgatggccaggctgaagctggccaataatggtgtggcccccaagtatttggccgtc
tggtcgagcgccctgaccaacaccaagtgtcttccaaatagtcaattcacggtgcaggtg
tggggcggcagcacttggcaggagaactacgaccttctggataatggatacaacgtgatc
ttctcgcacgttgatgcctggtacttggactgcggcttcggcagctggcggagcacagga
gaggccgcctgctccccctatcgcacctggcaaaacgtctacaagcatcggccctgggaa
cgcatgcgtctggacaagaagcggcgcaagcaggtattgggcggcgaggcctgcctgtgg
acggagcaggtggacgagaatcagctggacaatcggctgtggccccgtgccggtgccctg
ggcgagcgcctgtggtcggatcccagcgatgatcatgatctggatattatggccccggag
gtgttccgccgcatatcgctgtttcgcacccgtctcgtcgagctaggaatcaaggcggag
gccctgttccccaaatattgtgcccagaatcctggcgaatgcatttga

DBGET integrated database retrieval system