KEGG   Drosophila persimilis: Dper_GL10571Help
Entry
Dper_GL10571      CDS       T01063                                 

Definition
GL10571 gene product from transcript GL10571-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dpe  Drosophila persimilis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dpe00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dpe00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 201 aa AA seqDB search
MPSKEVVFYGLMAAIACVTTIATHHRLAVQLFEMQWAQSVHSHTVLDTFHQRVDLRYFAG
HVLVIVNIASQCGLTGQQYAGLTQLLAKYGERGLRILNFPCNQFGQQMPHSDGQEMMDHL
RQEKANIGDVFAKIEVNGPGAAPLYKLLTRNRSNLRGGKIEWNFVKFLVDRRGQVYARYG
AKAEPSALSGDIERLLGEGSK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcaaagaggtggtcttctatggcctaatggctgccattgcctgcgtgacgaca
atcgccactcaccacagactggcggtgcagctgttcgagatgcagtgggcgcagtcggtg
cattcgcacacggtgctagatacgtttcaccagcgggtggatcttcggtactttgccgga
catgtgctggttatcgtgaacatcgcctcccagtgtggattgacggggcaacagtatgcg
ggcctgactcagctgctggcgaagtacggggagcggggcctgcgaatcctcaactttccc
tgcaatcagtttggccagcagatgccgcattcggatggccaagagatgatggaccacctg
cgtcaggagaaggcgaatattggtgatgtctttgccaagatcgaggtgaatggacctggg
gccgcaccgctgtacaaactgctcacgcgaaaccgcagcaacctgcggggcggaaagatc
gagtggaactttgtcaagtttctggtggatcgtaggggccaggtctatgctcgctacggg
gccaaagcggagccatctgcactttccggtgacattgagcggctgctcggtgaagggtcc
aaataa

DBGET integrated database retrieval system