KEGG   Drosophila persimilis: Dper_GL10605Help
Entry
Dper_GL10605      CDS       T01063                                 

Definition
GL10605 gene product from transcript GL10605-RA
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
dpe  Drosophila persimilis
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dper_GL10605
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dper_GL10605
   00640 Propanoate metabolism
    Dper_GL10605
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Dper_GL10605
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    Dper_GL10605
Enzymes [BR:dpe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Dper_GL10605
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Dper_GL10605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2541 aa AA seqDB search
MLITLLVTLAAYIAFLFTLIFGRGQKRPVHAPSTTAASETETTTPINHNSSVIAATAPPV
TATSSLSSTATGGATTKLNEKRFPKGASIKKVQFSSESLKEVDIALSDLSYHQNHNNNTT
VIKNKNNNNSIVEIKNKSSVEMSEETNATPATDAERPSFLVGDEIDEKAAEAGEAVDEFP
QKMQSASRQNGDISEKRKRLSMLKRRTSKRFVLVESGEEPLVQAAAGAAAGASGSGPVIP
HFVAVDCGQSDSNHNEMSPSANTSPSSISINGGDSSNKNNNNNLSNPSPGLLSVPTVGTL
KPSMSRGTGLGQDRHQDRDFHIATTEEFVKRFGGTRVINRVLIANNGIAAVKCMRSIRRW
AYEMFKNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIALRT
QVQAVWAGWGHASENPKLPELLHKEGLVFLGPPERAMWALGDKVASSIVAQTAEIPTLPW
SGSDLKAQYSGKKIKITSDLFARGCVTNVEQGLAAVAKIGFPVMIKASEGGGGKGIRRVD
TTEEFPALFRQVQAEVPGSPIFVMKLARGARHLEVQLLADQYGNAISLFGRDCSIQRRHQ
KIIEEAPAIVAQPEVFEDMEKAAVRLAKMVGYVSAGTVEYLYDPEGRYFFLELNPRLQVE
HPCTEMVADVNLPACQLQIGMGIPLYRLKDIRLLYGESPWGSSIIDFENPPNKPMPSGHV
IAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGE
NRQQARENLVIALKELSIRGDFRTTVEYLITLLETNRFLENTIDTAWLDALIAERVQSEK
PDILLGVMCGALHIADRQITESFSSFQTSLERGQIQAANTLTNVQAAKSGANSYFLLMNS
SFKEIEVHRLSDGGLLISLEGASYTTYMKEEVDRYRIVIGNQTCVFEKENDPSLLRSPSA
GKLINLIVEDGAHVAKGQPFAEIEVMKMVMTLTSQEAGTVTFVRRPGAVLDPGSLLGHLE
LDDPSLVTKAQPCKSQFHQAENAPIPEKLNRVHNTYKSILENTLAGYCLREPFNAQRLRD
IIEKFMQSLRDPSLPLLELQEVIASISGRIPISVEKKIRKLMTLYERNITSVLAQFPSQQ
IASVIDSHAATLQKRADRDVFFLTTQSIVQLVQRYRNGIRGRMKAAVHELLRQYYDVESQ
FQHGHYDKCVGLVREHNKDDMLTVVNTIFSHSQVAKKNLLVTLLIDHLWANEPGLTDELA
NTLSELTSLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENL
QRLILSETSIFDILHDFFYHTNRAVCNAALEVYVRRAYTSYELTCLQHLELSGGLPLVHF
QFLLPTAHPNRLFSRMSSPEGLDQAAAESMGSSFVRTGAIAAFDSFEHFEMYSDEILDLL
EDFVSPAMVNAKVLEAVEAADSISDGRHSTSINVSLSDPVTRANAAEEAKSTEPIHIVSV
AVRETGDMDDLQMAQIFGSYCKEHNEELFQRRIRRITFAALKKRQFPKFFTYRARDKFEE
DRIYRHLEPASAFHLELNRMKTYNLEALPTANQKMHLYLGRAKVSKGQEVTDYRFFIRSI
IRHSDLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKRTDCNHIFLNFVPTVIMDP
AKIEESVTKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQAVRLCIANDSGYFLDISMY
TEQTEPETGIIKFKAYGEKQGSLHGHPISTPYMTKDFLQQKRFQAQSSGTTYVYDVPDMF
RQMTERHWKEFSNARPSVDIRIPDKILIECKELVLEGDSLIEMQRLPGENNCGMVAWRIV
LATPEYPNGREIIVIANDLTYLIGSFGIKEDVLFAKASQLARERKVPRIYISVNSGARIG
LAEEVKAMFKIAWEDPEEPDKGFKYLYLSTEDYAQVANLNSVRAILIEDEGEQRYKITDI
IGKDDGLGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIGSYVVRLGQRVIQIDNSH
IILTGYAALNKLLGRKVYASNNQLGGTQIMFNNGVTHKTEAIDLDGVYTILDWLSYIPAH
IGCDLPIVLPSDRIDRPVDFMPTKSPYDPRCMLAGRVNPTNANEWENGFFDRDSWSEIMA
PWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYK
TAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPN
AELRGGAWAVLDSLINPRYMETYADPEARGGVLEPEGIVEIKYKEKDLIKTINRLDATTI
ALKKEFEEATAAGDNTKAEQVDEKIKARLAQLMHVYHTVAVHFADLHDTPERMLEKECIS
EIVPWRGSRRWLYWRLRRLLLEDAYIKKILRAQDNLSVGQAKQMLRRWLVEEKGATEAYL
WDKNEEMVAWYEEQTNTESIVSRNVSSVRRDAIISTISKMLEDCPDVALDAVVGLCQGLT
PVNRGVVVRTLAQMQLNEGIL
NT seq 7626 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcacactattagtcactctggcagcatatatcgcgttcctcttcaccctgatc
tttggccggggccagaaaagaccagtccacgcgccatccaccacagcagccagtgaaaca
gaaactacaacaccgattaatcacaactccagcgtgattgcagctacagcaccaccagtc
acagccacaagcagcttgtcgtcgaccgcaacgggaggagccacaacaaagctgaacgag
aagcgattccccaaaggagccagcatcaagaaggttcagttctccagcgaaagccttaag
gaggtggatattgccttgtccgatctgagctatcaccagaaccacaacaacaacacaact
gtcatcaagaacaagaacaacaataatagcattgtcgaaatcaaaaataaatcatcagtc
gagatgagcgaggaaacaaatgccacgccagccacggatgcggagcgtccaagtttcttg
gtgggcgatgagattgacgaaaaggcagccgaagccggcgaggctgtggacgagttcccc
cagaagatgcagagcgcatcccggcagaatggcgatatatcggagaaacgcaagcgatta
agcatgttgaagcgtcgcaccagtaagcgttttgtacttgttgagtctggcgaggagccg
ctggtgcaggcagcagcaggtgctgcagcaggagcatctggatcgggccctgtcattcca
cactttgtggccgtggactgtggacagagcgacagcaaccacaatgagatgagtcccagc
gccaacaccagccccagtagcatctccatcaacggcggtgacagcagcaacaaaaacaac
aacaacaatctcagcaacccatcgccaggactccttagtgtgcccaccgtgggaacccta
aaaccgagcatgtcgcgtggcacgggcctgggccaggaccgccatcaggatcgtgacttt
catatagccaccaccgaggagtttgtgaagcgtttcggcggtacacgtgtcataaaccgc
gtcctcattgccaacaatggcattgcggctgtcaagtgcatgcgttccattcgccgatgg
gcctacgagatgttcaagaacgagcgggccatccgatttgtggtgatggtcaccccggag
gacctgaaggcgaatgccgagtacatcaagatggccgatcactatgtccccgtgcccggc
ggttccaacaacaacaactatgcgaatgttgagctcattgtggacattgcacttcgcaca
caagtgcaggctgtctgggctggatggggtcatgcctcggagaaccccaagttgccggag
ctgctgcacaaggagggtttggtgttcctcgggccaccggagcgcgccatgtgggcgctg
ggcgacaaggtggcatcctcgattgtggcccaaacggccgaaatacccacactaccatgg
tccggctccgacctgaaagcccagtacagcggcaagaagatcaagatcaccagcgacctt
tttgcccgcggctgtgtgaccaatgtggagcagggtctggcggctgtcgccaagattggc
tttcccgtgatgatcaaggcttcggaaggcggcggcggcaagggcattcgtcgcgtggac
accaccgaagagttccccgccctgttccgtcaggtgcaggctgaggtgcccggctccccc
atctttgtgatgaagctggctcgcggcgcacgccacttggaagtgcagctgctggcggat
cagtacggaaatgccatcagtctctttggccgcgattgctccatacagcgtcgccatcag
aagatcatcgaggaggccccggccattgtggcccagccggaggtgttcgaggacatggaa
aaggcggccgtgcgtctggccaagatggtgggctatgtgagcgccggcaccgtggagtac
ctatacgatccggagggcaggtacttcttcctggagctgaacccccgtctgcaggtggag
catccctgcacggagatggtggccgatgtcaatctgccggcctgccagctgcagatcggc
atgggcatccccctataccgcctcaaggacattcgcctgctgtacggcgagtcgccgtgg
ggctcctccatcattgactttgagaatccgccgaacaagcccatgccctcgggccatgtg
atcgctgcgcgcatcacctccgagaatcccgacgagggcttcaagcccagctcgggcaca
gttcaggagctcaacttccgctccagcaagaacgtctggggctacttcagtgtggccgcc
tccgggggattgcacgagtttgccgactcgcagttcggtcactgcttctcctggggcgag
aaccgacagcaggcgcgcgagaatctcgtgattgccctcaaggagctgtcgatccgtggc
gatttccgaaccaccgtcgagtacctgatcacgctgctcgagacgaatcgcttcctggag
aacaccatcgacacggcctggctggatgctctgattgccgagcgcgtgcagtccgagaag
ccggacatactgctgggcgtgatgtgcggggccctgcacattgccgatcgccagatcacc
gaatccttctccagcttccaaacgtcgctggagaggggccagatccaggcggccaacacc
ctgacgaatgttcaagcggccaagagcggcgccaactcgtacttcctgctgatgaacagc
tccttcaaggagatcgaggtgcaccgcctgtccgacggcggcctgctgatctccctcgag
ggcgcctcgtacaccacctacatgaaggaggaggtggaccgctaccgcatcgtgattggc
aaccagacgtgcgtcttcgagaaggagaacgatccgtcgctgctgcgcagcccatcggcg
ggaaagctcatcaatctgattgtggaggatggggcacatgtggccaagggccagcccttt
gccgagatcgaggtgatgaagatggtgatgaccctcacctcgcaggaggcaggcacggtg
acctttgtgcggcgtccaggcgccgtcctcgacccgggctccctgctgggccacctggag
ctcgatgatccctcgctggtgaccaaggcgcagccctgcaagagccagttccaccaggcc
gagaacgcgcccattcccgagaagctgaaccgcgtgcacaacacgtacaaaagcattttg
gagaacaccttggccggctactgcctgcgggagcccttcaatgcccagcggctgcgcgac
atcattgagaagttcatgcagagtctgagagatccatcgctgccgctgctggaactccag
gaggtgattgcctccatctcgggccgcatccccatctccgtggagaagaagatccgcaag
ctgatgaccctctacgagcggaacatcaccagtgtgttggcccagttcccctcccagcag
atcgccagcgtcatcgacagccacgcggccaccctgcagaagcgcgccgatcgcgacgtc
ttcttcctgaccacccagagcattgtgcaactggtgcagcgctaccggaatggcattcgc
ggccgcatgaaggccgccgttcacgaactgctgcgccagtactacgacgtggagtcgcag
ttccagcacggccactacgacaagtgcgtgggcctggtgcgggagcacaacaaggacgac
atgctgacggtggtgaacacgatattctcgcactcgcaagtggccaagaagaacttgctc
gttacgctactcatcgaccatctgtgggccaacgagccgggactcaccgacgagctggcc
aacaccctcagcgagctgacgtccctcaacagggccgagcactcgcgggtggctctgcgc
tctcgccaggtactgattgccgcccaccagccggcatacgagctgcgccacaaccaaatg
gagtcgatattcctgtcggccgtagacatgtacggccacgacttccatccggagaatctg
cagcgcctgatcctctcggagacctcaatctttgacattctccacgatttcttctaccac
acgaaccgagccgtgtgcaacgccgccctcgaggtgtacgtgaggcgcgcctacacctcc
tatgagctgacttgcctgcagcacttggagctgtccggcggcctgccgctggtgcatttc
cagttcctgctgcccacggcccatccgaatcgtctgttctcgcgcatgtcctcgccggag
ggactagaccaggcagccgccgagtcgatgggcagctcctttgtccgcaccggagcgatt
gccgccttcgattcgttcgagcactttgagatgtactcggacgagatactggaccttctc
gaggactttgtctcgcccgcgatggtcaatgccaaggtgctggaggctgtggaggcagcc
gactccatctcggacggccgtcacagcacctccatcaacgtctcgctgtcggatcccgtc
accagagccaatgccgccgaggaggccaagtccacggagcccattcacattgtgagtgtg
gctgtgcgggagaccggagatatggacgacttgcagatggcccagatcttcgggagctac
tgcaaggagcacaacgaggagctcttccagcgccgcattcggaggataacgtttgccgct
ttgaagaagcgccagttccccaagttctttacataccgcgcacgcgacaagttcgaggag
gatcgcatttatcggcacctggagccggcctctgccttccatctggagctgaaccgcatg
aagacctacaatctggaggccctgccgacggccaaccagaagatgcatctgtatttgggc
agggcaaaggtgtccaaggggcaggaggtgacagactatcgtttcttcatccgctcgatc
atccgccactcggacctcatcaccaaggaggcctcattcgagtacctccagaacgagggc
gaacgggtgctgctggaggccatggacgagctggaggtggccttctcccacccgcatgcc
aagcgcaccgactgcaatcacatctttctcaatttcgtgcccaccgttatcatggacccg
gccaagatcgaggagtccgtcaccaagatgatcatgcgctatggcccccgcctgtggaag
ctgcgcgtcctccaggccgagctgaagatggtcatccgccaatcgccgcagtcgcccacc
caagcggtgcgcctctgtattgccaacgattctggctacttcctggacatctcaatgtac
acggagcagacggagccggagacgggaattatcaagttcaaggcctatggagagaagcag
ggttcccttcacggccatcctatttcgacgccctacatgaccaaggacttcctgcagcag
aagcgcttccaggctcagtcgagcggcaccacgtacgtgtacgatgtgcctgacatgttc
cgccagatgaccgagcgccactggaaggagttctccaatgcccggccctccgtggacata
cgcatacccgacaagattctgattgaatgcaaggagctggtgctggagggcgacagcctc
attgagatgcagcgtctgccgggcgagaacaattgcggcatggtggcgtggcgcattgtc
ctggccacgccggagtacccgaatgggcgcgagatcattgtgatagccaatgatctgacc
tacctgattggctcctttggcatcaaagaggatgtgctgttcgccaaggcttcccagttg
gcgcgcgaacggaaagtgcccaggatatatatatcggtgaacagcggtgcccgcattgga
ctggccgaggaggtgaaggcaatgttcaagatagcatgggaggatcccgaggagccggac
aagggcttcaagtacctctatctgagcaccgaggactatgcccaggtggccaatctcaat
tcggtgcgtgccattctcatcgaggatgagggcgagcagcgctacaaaatcaccgacatc
atcggcaaggacgatggcctgggcgtcgaaaatctgcgctatgccggcctgattgccggc
gaaacgtcgcaggcgtacgaggagattgtcaccattgcgatggtcacctgccgcaccatc
ggcatcggctcctatgtggtgcgtctgggccagcgtgtcatccagatcgacaactcgcac
attatactcacggggtatgcggccctgaataagctgctcggtcgcaaggtatacgcctca
aacaaccaattgggcggcacgcagatcatgtttaacaatggcgtgacccacaaaactgag
gccatcgacttggacggcgtgtataccatcctcgactggctctcgtacattcccgcccac
attggctgcgacctgcccatcgttttgcccagcgatcgcatcgatcggcctgtcgatttt
atgcccaccaagtcgccgtacgatccgcgctgcatgctggccggtcgtgtgaatcccacc
aatgcgaatgagtgggagaatgggttctttgatcgtgattcctggagcgagattatggcc
ccgtgggccaagaccgtggtcacgggacgtgctcgactgggcggtgtgcctgtgggtgtt
attgccgtggagacgcgaactgtggaggtggaaatgcccgcggatccggccaacctggat
tcggaagccaagacactgcagcaggcgggtcaggtgtggtatcccgactcatcctacaag
acggcgcaagccatcaaggactttgggcgcgaggagttgccgctgattgtgttcgccaac
tggcgtggcttctctggcggcatgaaggacatgtacgagcagatcgtcaagtttggggcc
tacatcgttgacggactgcgggagtacaagaagccggtactcatctacctgccgcccaat
gccgagctgcgtggcggagcctgggccgttctggactcgttgatcaatccgcgctacatg
gaaacctatgcggatccggaggcccgaggtggtgtcctcgagcccgagggtattgtggaa
atcaaatacaaagagaaggacctcatcaagacgataaatcgtctggatgcgaccacaatt
gccctaaagaaggaattcgaagaggcaactgcagctggtgataacacgaaggccgagcag
gtggatgagaagatcaaggctcgtcttgcgcagctaatgcatgtctatcatacggtggcc
gtgcactttgccgacctacacgacacgcccgagcgcatgctggagaaggagtgcatcagc
gagattgtcccatggcgcggctcgcgacgctggctctactggcgcctgcgccgcctcttg
ctggaggatgcctacatcaagaagatcttgcgggcacaggacaatctctctgtcggacag
gccaagcagatgctcagacgctggctagtcgaagaaaagggtgccacagaggcatatctg
tgggacaagaatgaggaaatggtggcctggtatgaagagcaaacgaatacagaatctatt
gtctcccgcaatgtgagttccgtgcgacgggatgccatcatctcaaccatttcaaaaatg
ctcgaggactgtcccgatgtagcgctggacgctgtggttggcctctgtcaaggcctgact
cccgtcaatcgtggagtcgtcgtacgcacactggcgcaaatgcagctgaacgagggaatc
ctctag

DBGET integrated database retrieval system