KEGG   Drosophila persimilis: Dper_GL10837Help
Entry
Dper_GL10837      CDS       T01063                                 

Definition
(RefSeq) GL10837 gene product from transcript GL10837-RA
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dpe  Drosophila persimilis
Pathway
dpe04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dper_GL10837
Protein phosphatases and associated proteins [BR:dpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dper_GL10837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 DUF1398
Motif
Other DBs
NCBI-GeneID: 6590843
NCBI-ProteinID: XP_002015775
FlyBase: FBgn0148447
UniProt: B4GDK8
AA seq 170 aa AA seqDB search
MGNETSLPMEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgaaacatcactgcccatggaaatgtgttccaatttcgatgccgatgagatt
cgacgcttgggcaaacgtttccgcaaactggatctggacaattcgggggcattgagtgtg
gacgagttcatgtcgctgccggagctgcaacagaatccactggtgcagcgcgtgatcgac
atattcgatgccgatggcaacggggaggtggactttaaggagttcatccagggcgtctca
cagttcagcgttaagggtgataaactgtcgaagctgcgcttcgcgttccgcatctacgac
atggacaacgatggatacatttcgaatggtgaactttttcaggttttaaaaatgatggtg
ggcaacaatctgaaggacacgcaactgcaacagatcgtggacaagacaatcggtttcgcg
gacaaggatgaggatggcaagatatcgttcgacgaattctgttcggtggttggaaacacg
gacatacacaagaagatggttgttgacgtttaa

DBGET integrated database retrieval system