KEGG   Drosophila persimilis: Dper_GL10885Help
Entry
Dper_GL10885      CDS       T01063                                 

Definition
GL10885 gene product from transcript GL10885-RA
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dper_GL10885
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   Dper_GL10885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 312 aa AA seqDB search
MSQSPQHKRQKMSNGRNFEDYEELNIIGTGAYGTVYRARDTVTGNIVALKKIRIALNENG
VPMSTLREISLLKQLNASDHANIVKLFEVCQFLERDGQLMILLVFEHLEQDLSDLIERLP
KSGMSPITIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSAQGHLKIADFGLAKTYNSE
MKLTSVVVTLWYRAPEVLLIQPYNSSVDLWSAACIIFEMFNRKALFPGTSEKNQLDRIFE
LTGRPTDQQWPKTISVAREHFPHRLPKRPRDFCPNLCEFSDDLLNQMLSYDINMRPSALV
CLEHDYFTQEPL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcgcctcaacacaagcgtcagaagatgtccaatggaagaaactttgaggac
tacgaagaactcaacatcattggaacaggcgcctatgggactgtctacagggcccgggac
acagttacgggcaatattgtggccctgaaaaagatccgcatcgccctcaatgagaacgga
gtaccgatgtccacgttgcgggagatctccctgctgaagcagctcaatgcgagcgatcac
gccaacattgtcaaactgttcgaagtatgccagtttctggagcgcgacggacaactaatg
attctcctggtctttgagcacctggagcaggatttatctgacctcatcgaacgcctgccc
aaatcgggcatgtcccccatcacaatccagcgtctgtcgcgggagctcctgaccggcgtg
gactttctgcactcgcatcgcatcatccaccgcgatctgaaaccgcagaatctgctagtt
tccgctcagggccatctgaagatcgccgattttggtctggccaaaacgtacaactccgaa
atgaagctgacatcagtggttgttacgctgtggtatcgcgctcccgaggtacttcttatc
cagccctacaacagttccgtggatctctggagtgccgcctgcataatctttgagatgttc
aaccggaaggctctgttcccgggcacatcagagaagaaccagctggatcgtatattcgag
ctgacgggccgacccacagatcagcaatggcccaaaaccatctctgtggcacgggagcat
ttccctcaccgccttcccaagcggccacgtgacttttgtcccaacctgtgcgagttctcc
gatgacctgttgaatcaaatgctgtcgtacgacataaacatgcgcccctcggccctggtt
tgcctagagcacgattacttcacgcaggagcctctttaa

DBGET integrated database retrieval system