KEGG   Drosophila persimilis: Dper_GL10885Help
Entry
Dper_GL10885      CDS       T01063                                 

Definition
(RefSeq) GL10885 gene product from transcript GL10885-RA
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dpe  Drosophila persimilis
Pathway
dpe04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dper_GL10885
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dper_GL10885
Protein kinases [BR:dpe01001]
 Serine/threonine kinases: CMGC group
  CDK family
   Dper_GL10885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 6591061
NCBI-ProteinID: XP_002015692
FlyBase: FBgn0148495
UniProt: B4GDA6
AA seq 312 aa AA seqDB search
MSQSPQHKRQKMSNGRNFEDYEELNIIGTGAYGTVYRARDTVTGNIVALKKIRIALNENG
VPMSTLREISLLKQLNASDHANIVKLFEVCQFLERDGQLMILLVFEHLEQDLSDLIERLP
KSGMSPITIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSAQGHLKIADFGLAKTYNSE
MKLTSVVVTLWYRAPEVLLIQPYNSSVDLWSAACIIFEMFNRKALFPGTSEKNQLDRIFE
LTGRPTDQQWPKTISVAREHFPHRLPKRPRDFCPNLCEFSDDLLNQMLSYDINMRPSALV
CLEHDYFTQEPL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcgcctcaacacaagcgtcagaagatgtccaatggaagaaactttgaggac
tacgaagaactcaacatcattggaacaggcgcctatgggactgtctacagggcccgggac
acagttacgggcaatattgtggccctgaaaaagatccgcatcgccctcaatgagaacgga
gtaccgatgtccacgttgcgggagatctccctgctgaagcagctcaatgcgagcgatcac
gccaacattgtcaaactgttcgaagtatgccagtttctggagcgcgacggacaactaatg
attctcctggtctttgagcacctggagcaggatttatctgacctcatcgaacgcctgccc
aaatcgggcatgtcccccatcacaatccagcgtctgtcgcgggagctcctgaccggcgtg
gactttctgcactcgcatcgcatcatccaccgcgatctgaaaccgcagaatctgctagtt
tccgctcagggccatctgaagatcgccgattttggtctggccaaaacgtacaactccgaa
atgaagctgacatcagtggttgttacgctgtggtatcgcgctcccgaggtacttcttatc
cagccctacaacagttccgtggatctctggagtgccgcctgcataatctttgagatgttc
aaccggaaggctctgttcccgggcacatcagagaagaaccagctggatcgtatattcgag
ctgacgggccgacccacagatcagcaatggcccaaaaccatctctgtggcacgggagcat
ttccctcaccgccttcccaagcggccacgtgacttttgtcccaacctgtgcgagttctcc
gatgacctgttgaatcaaatgctgtcgtacgacataaacatgcgcccctcggccctggtt
tgcctagagcacgattacttcacgcaggagcctctttaa

DBGET integrated database retrieval system