KEGG   Drosophila persimilis: Dper_GL11041Help
Entry
Dper_GL11041      CDS       T01063                                 

Definition
GL11041 gene product from transcript GL11041-RA
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dper_GL11041
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C86
   Dper_GL11041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 193 aa AA seqDB search
MPTTLKIYHEKQTRQLCALHALNNLFQENIYQKAELDNICSNLSPNAWINPHRSLLGLGN
YDINVIMTALEIRHCEAFWFDKRKDPSCIDLDKIVGFILNIPLDYKIGAITLPIRKRHWI
AVRRIGQHYYNLDSKLRQPELLGTESDVLHFLREQLKEKEQQRELFLVRYRSDCNESPQR
WIEESHDINKTAD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaactttgaagatttatcatgagaagcaaacaaggcagttatgtgcgctccac
gctcttaacaatctatttcaagaaaatatttaccaaaaggcagaactggataatatctgc
agtaacttaagtccaaacgcgtggataaatcctcatcgatctcttctgggactcggaaat
tatgatatcaatgttattatgactgccttagagataagacattgcgaagccttttggttt
gataaacgaaaagacccgtcttgcattgacttggataaaattgtggggttcatacttaat
attccattagattacaaaatcggcgcaataacattaccaatacgaaagagacactggata
gctgtacgtcgcataggtcagcactactataatctggattccaaacttcgacagcctgaa
ttgttgggcacagaatccgacgtgctccactttttgcgggaacagcttaaggaaaaggaa
cagcagcgagaactttttcttgtacgttatcgcagcgactgtaatgaatcaccacagcga
tggatagaagaatcgcacgacataaataaaacagcagattga

DBGET integrated database retrieval system