KEGG   Drosophila persimilis: Dper_GL11275Help
Entry
Dper_GL11275      CDS       T01063                                 

Definition
GL11275 gene product from transcript GL11275-RA
Orthology
K14298  
mRNA export factor
Organism
dpe  Drosophila persimilis
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dper_GL11275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 347 aa AA seqDB search
MFGATQSSNRMNDFEVASPPDDSVSALEFSPSTLPSKNFLIAGSWDSSVRCWEVEQNGAT
VPKSIKSMGGPVLDVCWSDDGTKVFMASCDKQVKLWDLGSDQVMQVAAHDGPVKTCHMVK
GPNYTCLMTGSWDKTLKFWDTRSPNPMMAINLPERCYCADVEYPMAVVGTASRGLIIYSL
QNTPSEYKRQESPLKYQHRTISIFRDKKKEPTGYALGSIEGRVAIQYVNPANPKDNFTFK
CHRSTSTSGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSDAMDQSITK
CGFNSNGQIFAYAVGYDWSKGHEYFNPGKKPQIFLRSCYEELKPRIN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtttggggccacacaatcatcgaatcgcatgaacgatttcgaggtggcatcgccgccc
gacgactctgtttcggcattggagttcagcccaagcacattgccttccaaaaacttcctg
attgccggcagctgggacagcagcgtacgttgttgggaggtggaacagaatggagcaaca
gtgccaaaatcaataaaatcaatgggcggaccagtgctcgatgtgtgctggtctgacgat
ggtacgaaagtgtttatggcgtcctgcgataaacaagtaaagctctgggacttgggatcg
gatcaagtaatgcaagtggcggctcacgatgggccagtaaaaacatgtcacatggtaaag
gggccgaactacacgtgtctgatgacaggatcctgggataaaacattgaagttttgggat
acccgatcgcccaacccaatgatggcaatcaacttacctgaacgctgctattgtgcggat
gtggagtatcccatggccgttgtgggcactgcatcgcggggcctaatcatatactcgctg
cagaatactcctagcgagtacaagcggcaggagagtccattgaaatatcagcatcgcacc
atatcgatttttagggataagaaaaaagagcccactggatacgctttgggcagtattgag
ggtcgcgtagccatccaatacgtgaatccggctaatcccaaagataacttcacgttcaag
tgtcatcgctccacaagcacctctggcttccaggacatttacgccgtaaacgacatagca
ttccatccggtgcatggcactctggtcacagtcggctctgatggcacattcagcttctgg
gataaggacgcccgtactaagctcaagtctagtgatgccatggatcagtctataaccaag
tgcggattcaattcgaatggccaaatattcgcttacgcggttggatacgattggtcgaag
ggccatgagtacttcaatccaggaaagaagccacaaattttcttgcgctcgtgctacgag
gaattaaagccaaggatcaattga

DBGET integrated database retrieval system