KEGG   Drosophila persimilis: Dper_GL11275Help
Entry
Dper_GL11275      CDS       T01063                                 

Definition
(RefSeq) GL11275 gene product from transcript GL11275-RA
  KO
K14298  mRNA export factor
Organism
dpe  Drosophila persimilis
Pathway
dpe03013  RNA transport
Module
dpe_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dper_GL11275
Messenger RNA biogenesis [BR:dpe03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dper_GL11275
Chromosome and associated proteins [BR:dpe03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dper_GL11275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 6590365
NCBI-ProteinID: XP_002015845
FlyBase: FBgn0148884
UniProt: B4G9Y3
AA seq 347 aa AA seqDB search
MFGATQSSNRMNDFEVASPPDDSVSALEFSPSTLPSKNFLIAGSWDSSVRCWEVEQNGAT
VPKSIKSMGGPVLDVCWSDDGTKVFMASCDKQVKLWDLGSDQVMQVAAHDGPVKTCHMVK
GPNYTCLMTGSWDKTLKFWDTRSPNPMMAINLPERCYCADVEYPMAVVGTASRGLIIYSL
QNTPSEYKRQESPLKYQHRTISIFRDKKKEPTGYALGSIEGRVAIQYVNPANPKDNFTFK
CHRSTSTSGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSDAMDQSITK
CGFNSNGQIFAYAVGYDWSKGHEYFNPGKKPQIFLRSCYEELKPRIN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtttggggccacacaatcatcgaatcgcatgaacgatttcgaggtggcatcgccgccc
gacgactctgtttcggcattggagttcagcccaagcacattgccttccaaaaacttcctg
attgccggcagctgggacagcagcgtacgttgttgggaggtggaacagaatggagcaaca
gtgccaaaatcaataaaatcaatgggcggaccagtgctcgatgtgtgctggtctgacgat
ggtacgaaagtgtttatggcgtcctgcgataaacaagtaaagctctgggacttgggatcg
gatcaagtaatgcaagtggcggctcacgatgggccagtaaaaacatgtcacatggtaaag
gggccgaactacacgtgtctgatgacaggatcctgggataaaacattgaagttttgggat
acccgatcgcccaacccaatgatggcaatcaacttacctgaacgctgctattgtgcggat
gtggagtatcccatggccgttgtgggcactgcatcgcggggcctaatcatatactcgctg
cagaatactcctagcgagtacaagcggcaggagagtccattgaaatatcagcatcgcacc
atatcgatttttagggataagaaaaaagagcccactggatacgctttgggcagtattgag
ggtcgcgtagccatccaatacgtgaatccggctaatcccaaagataacttcacgttcaag
tgtcatcgctccacaagcacctctggcttccaggacatttacgccgtaaacgacatagca
ttccatccggtgcatggcactctggtcacagtcggctctgatggcacattcagcttctgg
gataaggacgcccgtactaagctcaagtctagtgatgccatggatcagtctataaccaag
tgcggattcaattcgaatggccaaatattcgcttacgcggttggatacgattggtcgaag
ggccatgagtacttcaatccaggaaagaagccacaaattttcttgcgctcgtgctacgag
gaattaaagccaaggatcaattga

DBGET integrated database retrieval system