KEGG   Drosophila persimilis: Dper_GL11337Help
Entry
Dper_GL11337      CDS       T01063                                 

Definition
GL11337 gene product from transcript GL11337-RA
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
dpe  Drosophila persimilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dpe00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1667 aa AA seqDB search
MVLEGFCRSVLRYVYALLQFLMRYHAFRWLVDLVDLQAVDKVHRENALLQQRGEEEQPGE
PKEEEKVQRQKQQQQQQQQRQNEATVVAGKTTKTKPDSVAISAMGNAGSASIREPVSNRT
TRHSEMSTMGEDTESHSIPISEGQNAEHVLYRLKRGTRLDVHPDASLLGKKIVLYTNYPA
EGQKFVRTDYRVLGWQLKNGKQITTVMHPEAHVVDTDIHSQLQLKLSGTYHFYFRYVERA
DTGSAGADGALYVQVEPTLHVGPPGAQKTIPLNSVRCQTVLTKLLGPLSSWEPKLRVAKE
AGYNVIHFTPIQELGGSHSAYSLRDQLKVNPSFASKKGDKVTFQDVEKIIKKCRQEWGVA
SICDIVLNHTANESEWLLQHPDATYSCASCPYLRPAFLLDAALAQCGADIAAGSLEHVGV
PLVIDQECHLEALKYQLHNAYLSKVNIHELYQCDVMQYVNNFMNQVRTREPPKNVANESR
FQEIQLIQDPAYRRLGSTINFELALEIFNAFHGDCFDEESRFRKCAETLRHHLDGLNDRV
RAEIQGYLNYAVDNCLAGIRYERVQGDGPRVREISEKHSVFMTYFTHTGTLGKTLPEIEA
DMYTKPGEFFMAHNGWVMGSSDPLLDFAEEQPGRANVYLKRELIAWGDSVKLRFGKRPED
SPYLWKHMTEYVETTARIFDGVRLDNCHSTPLHVAEYLLDAARKINPELYVVAELFTNSD
GTDNVFVNRLGITSLIREALSAWDSHEQGRLVYRYGGAPVGGFYPNPTRHEASSVAHALF
MDLTHDNPSAVEKRSVYDLLPSSALVSMACCATGSNRGYDELVPHHIHVVDEQRLYQEWG
KGVDSKSGIMGAKRALNLLHGQLAEEGFTQVYVDQMDPNVVAVTRHSPITHQSVILVAHT
AFGYPNPNAGPTGIGPLRFDGVLDEIILEASLTMKSDKPFDRPAPFKKDPNVLNGFTQFE
LSLQEHIPLSKSTVFQTHANVDGNNTVLNFVNLRPGTVVAIRVSMHPGPRISFDRLQKLT
NALRLGSGAEWSELQGIVSKLDLVALSAALFQCDDEERAQGTGGSAYDIPNFGRIVYCGL
QGFVSLLTEISPHNDLGHPLCTNLRDGNWMMDYMADRLTNFEDLKPLSVWLKAAFEPLKN
IPRYLIPCYFDAIVSGVYNVLLNQVNELMPDFIKNGHSFTQSLALSTLQFLSVCKSANLP
GFSHAINPPKPPKQCVTLSAGLPHFSTGYMRCWGRDTFIALRGSMFLTGRFNEARYIIIG
FGQTLRHGLIPNLLDSGSKPRYNCRDAVWWWMYSIRQYVEEAPKGSEILKDKVSRLFPYD
DADAHAPGAFDQLLIDVMQEALQVHFQGLQYRERNAGREIDEHMVDQGFNNHIGVHPETG
FVFGGNNFNAGTWMDKMGSSQKAGNKGRPSTPRDGSAVELIGLQYSVLRFMQGLAEKEAI
PYTGVDRKGPSGELTKWSYKEWADRIKDNFDRHFFVPESETCSLANKRFIYKDSYGATQS
WTDYQLRCNFPITLTVASELCNPQNAWRALELAKQYLLGPLGMKTLDPEDWNYRANYDNS
NDSTDCTVAHGSNYHQGPEWVWPIGFYLRARLIFAKKCGHLDETIAETWAILRAHLREMQ
TSHWRGLPELTNDNGSYCGDSCRTQAWSVAAILEVLYDLHALGADVA
NT seq 5004 nt NT seq  +upstreamnt  +downstreamnt
atggtgttagaagggttctgcaggagcgtcctgcgctatgtgtacgcactgctccagttc
ttgatgcgctatcatgcctttcgctggctcgtcgatttagtggatttgcaagcggttgat
aaggtacatcgcgagaatgctctgttacaacaaagaggagaagaagaacaacccggggaa
ccaaaagaagaagagaaagtacagcgacagaagcagcagcagcagcagcagcaacagcgg
cagaatgaagcaacagttgtcgccggcaaaacaacgaaaacaaaaccagattcagtcgcg
attagtgcaatgggaaatgcaggcagtgcttctattcgtgagcccgtatcaaatcgaacc
acccgccacagtgagatgagtaccatgggcgaagatacggaatcgcacagcatacccata
agtgaaggacagaacgctgagcatgtgctgtaccgcctgaagcggggcacccggctggac
gtgcacccggacgcctcgttgctgggaaagaagatcgtcctgtacaccaactatcccgcc
gagggccagaagttcgtgcgcaccgactaccgtgtgctcggatggcagctgaagaatggc
aaacagatcacgactgtcatgcatccggaggctcatgtggtggacacggatatccacagt
cagctgcagctgaaactgtccggaacgtatcacttctacttccgctatgttgagcgagca
gacaccggaagtgctggagccgatggggctctctatgtccaggtggagcccaccctgcat
gtggggccgccgggggcacaaaagacaatacctctgaattcggtgcgctgccagacggtg
ctaaccaagctactgggaccgctcagcagctgggagccaaagttgcgcgtggccaaggag
gccggctacaatgtgattcacttcacacccatccaggagctgggcggctcgcactccgcc
tactcgctgcgggatcagctgaaagtcaacccaagcttcgcaagcaagaagggcgacaag
gttaccttccaggacgtggagaagatcatcaagaagtgtcgccaggagtggggcgtggcc
tccatctgcgacattgtgctgaatcacacggccaacgagtcggagtggctgctccagcat
ccggatgccacctactcgtgcgcctcgtgtccgtacctgcggccagccttcctgctggac
gccgccctggcccagtgcggagccgacatcgctgctggcagcctggagcatgtgggcgtg
cctctggttatcgatcaggagtgccatttggaagctttaaagtaccagttgcataacgcc
tacctatccaaggtcaatatacacgagctgtatcagtgcgacgtgatgcagtatgtgaac
aacttcatgaaccaggtgcgtactcgcgagccgcccaagaacgtggccaacgagtcgcgt
ttccaggagatccagctgatacaggacccggcatatcgacgcttgggtagcaccatcaat
ttcgagctggcgctggagatctttaatgctttccatggcgattgtttcgatgaggagtca
cgcttccgcaagtgcgccgagaccctgcgccaccacttggatggcctcaacgatcgcgtg
cgggccgagatccaaggctatctgaactacgccgtcgacaattgcctggccggcatccga
tacgagcgagttcagggcgacggtcccagagtgcgcgaaatatcagaaaagcactctgtc
tttatgacctacttcacccacacgggcaccctgggcaagacgctgcccgagatcgaggcc
gatatgtacaccaagccgggcgaattctttatggcccacaacggctgggtcatgggctct
agcgatccattgcttgactttgccgaggagcagccgggacgcgccaatgtctacctcaag
cgagagctcattgcctggggcgacagcgtgaagctccgttttggcaagcggccagaggat
agcccctacctgtggaagcacatgaccgagtacgtggagacgacggcccgcatattcgac
ggagtccggctggacaactgccactcgacgccgcttcacgtggccgagtacctgctggac
gcggcgcggaagatcaaccccgaactgtatgtggtggccgagctgttcaccaactccgat
ggcaccgacaatgtgttcgtcaatcgcctgggcatcacatccctaattcgcgaagccctt
tcggcctgggactcgcacgagcagggccgtctggtctatcggtatggcggtgcgccagtc
ggtggcttctatccgaatcccacgcgtcatgaggcgtccagcgttgcacacgccctgttc
atggacctcacccacgacaatccatcggccgtggaaaaacggtccgtctacgatctgctg
ccctcgtctgctctggtctccatggcctgctgtgccaccggcagcaatcgtggctacgac
gaactggttccacatcatatccatgtcgtggacgaacagcgtttataccaggaatggggc
aagggcgtggactccaagtccggcattatgggagctaagcgagcgctgaatctgctgcac
ggacagctggccgaagagggatttactcaggtgtatgtggaccaaatggaccccaatgtg
gtggctgtcacccggcattccccgatcacccatcagtcggtcattctggtggctcacacg
gccttcgggtatccgaatccgaatgccggacctactggcatcggaccgttgcgctttgac
ggcgttttggacgagatcatcctggaggccagcctgaccatgaagagcgacaagcccttc
gatcgtcccgctccctttaagaaggatcccaatgtgttgaacggcttcacccagttcgaa
ctgagcctgcaggagcacatcccgctcagcaagtcgaccgtctttcagacccatgccaat
gtcgatggcaacaacacggtgctgaactttgttaaccttcggcctggcacagtggtagcc
attcgagtgtccatgcatcccggaccccgcatcagcttcgacaggctgcagaagctgaca
aatgccttgcgcctgggatcgggggctgagtggtcagagctgcaggggatcgtatccaaa
ctggatttggtggcgctgagtgccgccctctttcaatgtgacgacgaggaacgtgcccaa
ggcacaggtggctccgcctacgatatacccaactttgggcgcattgtctactgtggcctc
cagggctttgtttccctgctgacggagatatcgccacacaatgatctgggccacccgctg
tgcactaatttacgcgacggcaactggatgatggattacatggccgatcgcctgaccaac
ttcgaggatttaaagccgctctccgtctggctgaaggccgccttcgagcctctgaagaat
ataccacgctacctcattccctgctatttcgatgccattgtcagcggggtctacaacgtg
ctcctcaatcaggtcaacgaactgatgccagatttcattaagaacggccacagtttcact
cagtccctggccctctccacgttgcagttcctttccgtctgcaagtccgccaatctgcca
ggcttcagtcatgccatcaatccaccaaagccaccgaaacaatgtgttacactctctgct
ggactgccgcatttctccactggttacatgcgctgctggggccgtgataccttcatcgcc
ctgcgtggatcgatgttcctgactgggcgtttcaacgaagctcgatacatcattattgga
ttcggccagaccctgagacatggtctcatacccaatctcttggacagcgggagcaagccg
cgctacaactgccgcgatgccgtctggtggtggatgtactcaatcaggcagtacgtggag
gaggctcccaagggaagcgagatactgaaggacaaggtgtcgcgcctctttccctacgac
gatgccgatgcacatgcaccaggggccttcgatcagctgctcatcgatgtgatgcaggag
gcgctgcaggtgcatttccagggactgcaatatcgcgaacgcaacgcgggccgtgagata
gatgagcatatggtggaccagggattcaacaatcacattggagtgcatccggaaactggc
tttgtgtttggcggaaacaactttaatgctggcacgtggatggacaagatgggctcgtcg
cagaaggccggcaacaaggggcggccgagcaccccacgcgatggatccgctgtggagttg
attggcctccaatattctgtattgcgcttcatgcagggcctggccgaaaaggaggccatc
ccgtacacgggtgtggatcgcaaggggccgtcaggtgagttgacaaagtggagctacaag
gagtgggcagatcgcatcaaggacaacttcgatcgccatttctttgtcccggagtcagag
acatgttccttggcaaacaagaggttcatctacaaggacagctacggcgcaacccagagc
tggacagactatcagctccgttgtaacttccccatcacactgaccgtcgcttcggagctt
tgcaatccgcagaacgcctggcgtgctctggagctggccaagcagtacctgcttggacca
ctgggcatgaagacactggatcccgaggactggaactacagggctaactatgataactcc
aacgactcgacggattgcaccgttgcccatggatccaactaccaccagggacccgagtgg
gtatggcccattggcttctacctgcgggctcgtctcatcttcgccaagaagtgcggccat
ctagatgaaaccattgctgagacctgggccattctgcgggctcatctccgtgagatgcag
acctcccactggcgtggcctgcccgagctgaccaacgacaatggctcctactgcggcgac
tcctgccgcacccaggcctggagcgtggccgccattctcgaggttctctacgatctgcac
gccctaggagcggacgtagcttag

DBGET integrated database retrieval system