KEGG   Drosophila persimilis: Dper_GL11348Help
Entry
Dper_GL11348      CDS       T01063                                 

Definition
GL11348 gene product from transcript GL11348-RA
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
dpe  Drosophila persimilis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dper_GL11348
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dper_GL11348
   00600 Sphingolipid metabolism
    Dper_GL11348
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    Dper_GL11348
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dper_GL11348
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dper_GL11348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 427 aa AA seqDB search
MYRTSSVFLGTFLLLLLLHGGMGLDNGLALTPPMGWMSWERFRCLTDCKLYPNECISEEL
FRRHADLLVSEGYADAGYEYIIIDDCWLEKNRDNKTKKLVADKKRFPNGLNPLADHIHNI
GLKFGLYQDYGTNTCAGFPGVIKHMQLDAQTFADWDVDYVKLDGCYANISDMAVGYPEFG
RLLNATGRPMVYSCSWPAYQEDAGEMPDYTSLKQHCNLWRNWDDIDDSLESVAQIMDYFG
KNQDRIQPHAGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWSVMAAPLIMSNDLAVVRPEI
KDILQNRVCSAFEDLKIKVIAVDQDELGIQGRRILSKNQIEVWSRPITPVVSNNQHSYAV
AFVSRRADGAPYRIVFTLKELELHNTAGYDVQDLYDDKNHLGVFRPANQFITRVNPNGVT
FYKFTAL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtacagaacgtcgagcgtctttttggggacttttctccttctgctgctgctgcacggc
ggaatgggactcgacaatggactggcactcacgccaccaatgggctggatgtcctgggag
cgtttccgctgcctaacagattgtaagctttatccaaacgagtgcataagtgaggagctg
ttccggcggcatgcggatttgctggtgtccgagggctatgccgatgctggctacgagtac
atcatcatagatgactgctggctggagaagaaccgcgacaacaagaccaagaaattagtt
gcagacaagaagcgattccccaacggactgaatcctcttgcagatcatatacacaatatt
ggactgaagttcggcttgtaccaggactacggcacgaacacctgcgctggttttcctgga
gtcataaagcacatgcaactggatgcccagacctttgccgactgggacgtggactatgtc
aagctggatggctgctatgccaacatcagcgatatggccgtgggatacccagagttcgga
cgtctgctcaacgcgactggccgcccaatggtctattcctgcagctggcccgcataccag
gaggatgctggagaaatgcccgactatacgtccttgaagcagcactgcaacctgtggcgc
aactgggacgacatcgacgattcgctcgagtctgtggcacagattatggactactttggc
aagaaccaggataggatccaaccacatgcagggccaggccactggaacgatcccgatatg
ctactgctgggcaactacggactgagctacgatcaaagtaagctgcaaatggccatttgg
tccgttatggcagcgccgctgatcatgtccaacgatttggccgtggtacgtccagaaatc
aaggatattctgcagaatcgggtttgttcagccttcgaggatttgaagattaaagtgatt
gctgtggatcaagatgagttgggcatccagggccgtcgtatcctgtcaaaaaatcagatc
gaagtctggagcagacccatcacgccggtggtcagcaataaccagcactcttatgccgtg
gcctttgtcagccgacgcgctgatggtgctccctacagaatcgtattcacactcaaggag
ctcgaactacacaataccgcaggctacgatgtacaggacctctacgatgacaaaaatcac
ttgggcgtcttccgcccagccaaccagtttatcacgcgcgttaatccgaatggtgtaact
ttctataagtttacagcactctga

DBGET integrated database retrieval system