KEGG   Drosophila persimilis: Dper_GL11461Help
Entry
Dper_GL11461      CDS       T01063                                 

Definition
GL11461 gene product from transcript GL11461-RA
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
dpe  Drosophila persimilis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dper_GL11461
Messenger RNA biogenesis [BR:dpe03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Dper_GL11461
Translation factors [BR:dpe03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dper_GL11461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 690 aa AA seqDB search
MAKKKSEDHSGGDANDSDYNEEPNFEDPPNFVDNISDDDLLGDMLAQRPSEADGVESVVV
VDNIPKVEPVRLEKLKSVINKLFSHCGDIVNVVYPVDEEGKTKGYAFMEYKHAGQAEEAV
KKLNNHRLDKNHTFAVNLFTDFQKYENIPEKWEPPTVQSFKVQNDLYNFINDPDAYDQYC
VAAETSQNCVQVGFWQNVLPEPNELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSS
FQKIQKFPHTGTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGAEKRSFVADGMSVLSM
FRWSHDDKYVARMGDNSIHIYETPSFYLLDLKSIKIPGIRGFSWSPTDNVIAYWVEEQNQ
IPARVTLMEIPKKRETRNKNLFHVADCKLHWQKSGDYLCVKVDRYSKLKKDKKELDVKFL
GMFYNFEIFHMREKEVPVDSVEIRELILAFAWEPIGNKFSIIHGEPNSANVSFYEVNKGV
KPSLVKRLEKKSCTHLFWSPRGQFIVMANLTMGTFEFVDSTNDYIISASPDHFRASEVEW
DPTGRYVVTGVSSWKVKEDTGFNMYTFQGRIIKRTILKNFVQFLWRPRPPTLLSEDKQKD
IKKNLKKYYPAFEQKDRLRLTRASKELLEKRSQLRETFMEYRNKRIGEWKEQKSRRVMLR
GHVDTDNLETEEVDEEVVEFLVKEEITLLE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaagaagagtgaagaccattccggtggcgatgcgaacgacagtgactacaac
gaggaacccaatttcgaagatccgcccaatttcgtggacaatattagcgatgatgatctg
ctcggtgacatgctggcgcagcggccttctgaggccgacggtgtcgagagcgttgtcgtg
gtggacaatatccctaaggtggagccggtgcgtttggaaaaattgaaatcggtcatcaac
aagctcttctcgcactgcggcgatatcgtgaatgttgtttatcctgtcgacgaggagggc
aagacgaagggctatgcgttcatggagtacaagcacgccggccaggcggaggaagccgtc
aagaagctgaacaaccatcggctggataagaaccatacgtttgctgtgaatttgtttacg
gatttccagaagtacgagaacatcccggagaaatgggaaccaccaactgtgcagtccttc
aaggtgcaaaacgatctgtacaacttcatcaatgaccccgatgcgtatgaccaatactgt
gtggcagcggaaacttcccagaactgcgttcaggttggcttctggcagaatgttctgccc
gagcccaacgagctggagacccgcgaacggttcacggacacttttgtcaagtggtcgccc
ctgggcacgtatgtggtgacgttccacaagcccggcgtggccatttggggtggcagcagt
ttccagaagatccagaagttcccccacactggaacacagtttgtggagttctcgccctgc
gaaaactatttggtaacctacggccccactccgacaggtcagaagattatcatttgggac
atacgcactggcgctgagaagcgctcgtttgtggccgacggcatgtcggtcctgtctatg
ttccgttggtcgcacgacgacaagtatgtggccaggatgggcgacaactcgatccacatc
tatgaaacaccctccttctatctgctggatctgaaatccatcaagattcctggcatccga
ggattctcctggtcgcccacggacaatgtgattgcctactgggtggaggagcagaatcaa
atacctgcccgcgtcaccttaatggagattcccaagaagcgggagactcgcaacaagaac
ctattccatgtggctgattgcaagctccactggcagaagtccggcgactatctgtgcgtc
aaagtagatcgctattccaagttgaagaaggacaagaaggagctggacgtcaagttcctg
ggtatgttctacaactttgagatcttccacatgcgggagaaggaggtcccagtcgattcg
gtggagattcgcgagctcatcctggcctttgcctgggagcccatcggcaacaagttctct
attatccacggcgagcccaactccgccaatgtgagcttctacgaggttaacaagggcgtg
aagccgagcctggtcaagcggctggagaagaaatcgtgcacgcatctgttctggtcgcca
cgaggacagttcatagtgatggccaatctgaccatgggcacctttgagtttgtcgattcg
accaatgactacatcatcagtgcgtcgcctgatcatttccgtgcctccgaggttgagtgg
gatcccactggccggtatgtggtcactggcgtctcttcctggaaggtcaaggaggatacc
ggcttcaacatgtacacgttccaggggcgcatcatcaagcgcaccattctgaagaacttt
gtgcagttcctttggcgtcccaggcctccgaccctcctcagcgaggacaagcagaaggat
atcaagaagaacttgaagaagtactatcccgccttcgagcagaaggatcgcctgcgactc
acccgcgcctccaaggagctgctcgagaagcgttcccaactgcgcgagaccttcatggag
tatcgcaacaagcgcattggcgaatggaaggaacagaagagtcgtcgcgtcatgctgcga
ggacatgtggacacagataacttggaaactgaagaggtcgatgaggaagttgttgaattt
ttagtcaaggaagaaatcactcttctagagtag

DBGET integrated database retrieval system