KEGG   Drosophila persimilis: Dper_GL11873Help
Entry
Dper_GL11873      CDS       T01063                                 

Definition
(RefSeq) GL11873 gene product from transcript GL11873-RA
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     Dper_GL11873
Peptidases [BR:dpe01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Dper_GL11873
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Dper_GL11873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
AA seq 405 aa AA seqDB search
MSGLYSTINTIFYATIIPGAIFIRWACAACKYALLFFILVLVVLPLVFRYSVTLQRGILF
LTFITYPKGLDLTNPAGIGLYATRNFYITVKDNESDEDGVRIGVWHVLPRNAVRRFKREL
KVEEAFDQDIVTDERRDDDYEQELRRLAPAIKSEFPSIVPENQQLFFERLLRMPGGTVVI
YLHGNTATRGSGHRSEVYKLLRNLNYHVLSFDYRGYADSDPVSPTEEGVVRDAMMVYEYI
ANVTSNPVIIWGHSLGTGVATHMCARLAHLKERAPRGVILESPFTNIRDEIRLHPFSRIF
KHLPWFDFAISRPMYSNRLRFESDIHVHEFPQPIMIIHAEDDVVVPFHLGYQLYRIALDS
RSRAWGPVEFHRFDRSKRYATSICAGRPSSPAWCTIWWITIACVY
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggctttatagtactataaacacaatattctatgctacaatcattcccggagcg
atcttcattaggtgggcctgcgctgcctgcaaatatgccctgctgttcttcatcttggtg
ttggtggtgctgccactggttttccgctactcggtgacgctccagcgcggcatcctcttc
ctcacattcatcacctacccgaagggcctcgacctcaccaatcctgccggcatcggactc
tacgcgacacggaacttctacataaccgtcaaggataatgaatcggacgaggatggggtg
cgcattggagtgtggcacgtgctgccgaggaacgcggttcgccgcttcaagcgggagctg
aaagtggaggaggccttcgaccaggacatcgtaacagatgagcgcagggacgacgactac
gagcaggagctcaggcgcctggctccggccatcaagtcggagttcccctcgatcgtgccc
gagaaccagcagcttttcttcgagcgtctactacggatgcccggcggtaccgtagtcatc
tatctgcacggcaacacggccacccggggcagcggccaccgctcggaggtgtacaagctg
ctgcggaacctcaactaccatgtcttgtccttcgactatcgcggctacgccgactcggat
cccgtctcgcccacggaggagggtgtggtccgggacgccatgatggtgtacgagtacata
gcgaatgtgacctccaatccggtcatcatatggggtcactctttgggcacgggcgtggcc
acgcacatgtgcgccaggctggcccatctgaaagagcgggcgccacgcggcgtcatccta
gagagcccgttcaccaacatccgagacgagatccggctccaccccttttcaaggatcttc
aagcacctgccctggttcgacttcgcgatctcgcgacccatgtacagcaaccggctgcgc
ttcgagtcggacatccacgtgcatgagttcccgcagcccattatgatcatccacgccgag
gacgacgtggtagtgcccttccacctgggctaccagctgtaccgcatcgccctcgacagc
cggagtagggcgtggggacccgtagagttccaccgctttgaccggagcaagcggtacgcc
acaagtatttgtgccgggcgcccgagctccccggcttggtgcaccatttggtggataact
atcgcatgcgtctactag

DBGET integrated database retrieval system