KEGG   Drosophila persimilis: Dper_GL11922Help
Entry
Dper_GL11922      CDS       T01063                                 

Definition
GL11922 gene product from transcript GL11922-RA
Orthology
K04646  
clathrin heavy chain
Organism
dpe  Drosophila persimilis
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dper_GL11922
   04142 Lysosome
    Dper_GL11922
Exosome [BR:dpe04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dper_GL11922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1680 aa AA seqDB search
MTQPLPIRFQEHLQLTNVGINANSFSFSTLTMESDKFICVREKVNDTAQVVIIDMNDSTN
PTRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMNEDVVFWKWISLNTLA
LVTETSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNATQQWLLLVGISALPSRVAGA
MQLYSVERKVSQAIEGHAASFATFKIDGNKEPTTLFCFAVRTATGGKLHIIEVGTPPNGN
QAFPKKAVDVFFPPEAQNDFPVAMQVSAKYDTIYLITKYGYIHLYDMETATCIYMNRISA
DTIFVTAPHEASGGIIGVNRKGQVLSVTVDEEQIIPYINTVLQNPDLALRMAVRNNLAGA
EDLFVRKFNKLFTAGQFAEAAKVAALAPKAILRTPQTIQRFQQVQTPAGSTTPPLLQYFG
ILLDQGKLNKFESLELCRPVLLQGKKQLCEKWLKEEKLECSEELGDLVKASDLTLALSIY
LRANVPNKVIQCFAETGQFQKIVLYAKKVNYTPDYIFLLRSVMRSNPEQGAGFASMLVAE
EEPLADINQTVDIFMEHSMVQQCTAFLLDALKHNRPAEGSLQTRLLEMNLMSAPQVADAI
LGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHMLNAEWLVSFFGTLS
VEDSLECLKAMLTANLRQNLQICVQIATKYHEQLTTKALIDLFESFKSYDGLFYFLSSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQ
FSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERFLKENQY
YDSRVVGRYCEKRDPHLACVAYERGQCDRELIAVCNENSLFKSEARYLVARRDAELWAEV
LSEANPYKRQLIDQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIILDSSVFS
DHRNLQNLLILTAIKADRTRVMDYINRLDNYDAPDIANIAISNQLYEEAFAIFKKFDVNT
SAIQVLIDQVNNLERANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSYIKADDPSAYVD
VVDVASKVESWDDLVRYLQMARKKARESYIESELIYAFARTARLADLEEFISGPNHADIQ
KIGDRCFSDGMYDAAKLLYNNVSNFARLAITLVYLKEFQGAVDSARKANSTRTWKEVCFA
CVDAEEFRLAQMCGLHIVVHADELEDLINYYQNRGYFDELIALLESALGLERAHMGMFTE
LAILYSKFKPSKMREHLELFWSRVNIPKVLRAAESAHLWSELVFLYDKYEEYDNAVLAMI
AHPTEAWREGHFKDIVTKVANIELYYKAIEFYLDFKPLLLNDMILVLAPRMDHTRAVSYF
SKTGYLPLVKPYLRSVQSLNNKAINEALNGLLIDEEDYQGLRNSIDGFDNFDNIALAQKL
EKHELTEFRRIAAYLYKGNNRWKQSVELCKKDKLYKDAMEYAAESGKQEIAEELLGWFLE
RNAHDCFAACLYQCYDLLRPDVILELAWKHKIMDFAMPYLIQVLREYTNKVDKLELNEAQ
REKEEDTTEHKNIIQMEPQLMITAGPAMGIPAQYAQNYPPGAATVAAATTTGRNMGYPYL
NT seq 5043 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccgctacccatccgctttcaggagcatttacagctcacaaacgttgggatc
aacgcaaactcgttctcattcagcacgctcacgatggagtcggacaagtttatttgtgtg
cgcgagaaagttaatgataccgcccaagtagtcatcattgatatgaacgattcgaccaat
cccacacgacgtcccatatcagctgactcggccattatgaatccagcaagcaaagttatt
gctctcaaagcgcaaaagacgttgcagatattcaatattgaaatgaaatcaaaaatgaag
gctcacacgatgaatgaagatgttgtgttctggaaatggatatctttgaacactttagca
ttggtgaccgagacgagcgtttttcattggtctatggaaggtgactcgatgccacaaaaa
atgtttgatagacattcctcactcaatggctgtcagataatcaattatcgctgcaatgct
acacaacaatggctgcttctggtaggcatatcggcacttcccagccgcgttgccggcgcc
atgcagttgtattccgtggagcgtaaagtatcgcaggccatcgaaggtcacgcagccagt
tttgcgacttttaaaatagacggaaacaaggaaccgactacgcttttttgctttgcagtt
cgcaccgccacaggcggcaagcttcacatcattgaagtcggaacaccgcctaatggcaac
caggcttttccaaaaaaggctgttgacgtcttctttccaccggaagcccagaacgacttt
ccagtggccatgcaggtctcagcgaagtacgataccatctatttgataaccaaatatgga
tatattcatctgtacgatatggagaccgccacatgcatatacatgaatcgcatatcggcc
gatacaattttcgtgaccgctccgcacgaggccagcggtggaattattggcgtcaaccgc
aagggtcaggtgctatctgtaactgttgacgaagagcagatcattccttatataaacact
gttttgcaaaaccctgacttggccctgcgaatggctgtacgaaacaatttagcaggagcg
gaggatctttttgtccgcaagttcaacaagctgtttactgccggtcagttcgccgaagcg
gccaaagttgctgctctggctcccaaggccattcttcgcactcctcagaccattcaacga
tttcaacaagtgcaaacaccagcaggctcgacgacgccacctctactgcagtactttggt
attctgctcgaccagggcaagttaaacaagtttgagtccctggagctgtgtcgtccagtt
ctgctgcaaggaaagaagcaactttgcgaaaaatggctaaaggaggagaaacttgagtgc
agcgaagaactaggtgatctcgttaaagcctcagacctcacgctagcgctctccatttac
ttgcgtgccaatgttcccaataaagtgattcagtgttttgcagaaactggacagtttcaa
aaaattgtgctttatgccaagaaggttaactatacaccagactacatttttctgctgcgt
tcggtgatgcgtagcaatcccgagcaaggtgctggttttgcatctatgcttgtagcagag
gaagagcctctggcggacattaaccagactgtcgatatcttcatggaacactctatggta
caacagtgcacggcttttttgttagatgcccttaagcacaatcgcccggccgagggttcg
ctgcagacgcgtttgcttgaaatgaatctcatgtctgccccacaggtggccgacgctata
cttggtaatgctatgttcacccactacgatagggcacacatcgcccagctgtgtgaaaaa
gcaggtttgttgcagcgtgctctggagcactacacagatctgtacgatataaagcgggct
gtcgtacacacgcatatgctgaatgctgagtggctggttagcttctttgggactttatcg
gtggaggactctctggaatgtctgaaggctatgttaacagcaaatctgcggcagaattta
caaatctgtgtacaaattgccaccaagtaccacgagcagttgaccaccaaggcgctaatt
gacctatttgagagctttaagagctacgacggactgttctatttcctaagcagtattgtg
aacttctcacaggatccagaggttcactttaaatacattcaagccgcctgtaagacaaac
cagataaaagaggtggaacgaatttgtcgcgaatctaattgttataacccggagcgcgtg
aagaatttcttgaaggaagctaaactgactgatcaactgccgctgattattgtttgtgat
cgttttgactttgtccatgatctggtgctgtacttataccgcaacaatctccaaaagtat
atagagatctatgtgcagaaggtaaacccttctcgcttgccggttgttgtgggtggtttg
cttgacgtcgactgcagtgaggatattatcaaaaatctcatactagtggtcaagggtcag
ttctctacggatgagctggtggaggaggttgaaaagcgtaatcgcttaaagctcctactt
ccctggcttgagtctcgggtccacgaaggctgcgttgagcccgccacacacaatgccttg
gccaagatttacattgattcaaataacaacccagaacgtttcctcaaagaaaatcagtac
tacgacagccgcgtggtcggtcgctactgtgaaaagcgtgatcctcatctggcctgtgtt
gcctacgaacggggccagtgcgatcgcgaattgatcgctgtctgtaacgaaaactcacta
tttaaaagtgaagctcgttatctagtggctcgacgtgatgccgaactctgggcggaggtc
ctgtccgaagctaatccatacaagcgccagttgattgatcaagtcgttcagacggcactg
tctgaaacacaggatcccgacgatatttcggtaacagtaaaggcatttatgactgctgac
ttgccgaatgagctgattgagctgctggaaaagatcatattggactcttcggtgttcagc
gaccatcgcaatcttcagaatctgctcatactcactgctattaaagctgatcgtacacgc
gttatggattatataaaccgactggacaattacgatgcaccggatatagccaacattgcg
attagtaatcaattgtatgaggaggcatttgccatattcaagaagttcgatgttaatacg
tcagccattcaggtgctcattgatcaggtcaacaatttggagagagccaacgagttcgcc
gagcgctgtaacgagccagccgtatggtcacagttagccaaggctcaactacagcagggt
ttagtgaaggaggctattgattcatatataaaggccgatgatccgagtgcttacgtggac
gtggttgacgtggctagtaaggtggaatcgtgggacgaccttgttcggtatcttcaaatg
gcacgtaaaaaagcgcgtgagtcctatattgagagtgaattaatttacgcttttgctcgc
actgctcgtttggccgatctcgaagagttcatatcgggtcccaaccacgcagacatacag
aaaattggagatcgctgtttcagtgacggaatgtacgatgctgcaaagctcctatataat
aatgtcagcaactttgcccgtttggctattacactggtatatcttaaggagtttcagggt
gctgttgactcggcgcgaaaggctaactcgacgcgcacatggaaggaagtttgttttgct
tgcgtagatgcggaagaatttcggctagcgcagatgtgtggcctacatattgttgttcat
gctgatgagctagaggatttgattaattattaccagaatcggggatatttcgatgagctg
atagcactacttgagtctgctctgggcctagaacgtgcgcatatgggaatgtttactgag
ttggccatactctactcaaaatttaaaccatcaaaaatgcgagaacacctagaactattc
tggtcccgcgttaacataccaaaagttctgcgagctgccgagtcggctcatctctggtcg
gagctagtgttcctttacgataagtatgaggaatatgacaacgctgtgctggccatgatt
gctcacccgactgaggcatggcgcgagggacactttaaggacatcgtaacaaaggtggca
aatattgagttgtactacaaggccatcgaattttatttagactttaagccgttgctgctg
aacgatatgattttagtgctggctccccgaatggatcatactcgagctgttagctacttt
tccaagaccggctacttgccgttggtcaagccctatttgcgctccgtacaatcccttaat
aataaagctatcaatgaagctcttaatggtctcttaatcgacgaggaggactaccaaggt
ctacgcaattcgatcgatggtttcgacaactttgacaacattgcgctggctcagaagctt
gagaagcatgagctcacagagtttcgtagaattgctgcatacttgtataaaggaaataac
cgttggaaacaaagcgttgagctgtgtaaaaaggataaactttacaaggatgccatggag
tatgccgctgagtctggaaagcaagagattgctgaagagttgttgggatggttccttgag
cggaatgcacacgattgctttgcggcatgtctttatcagtgctacgatttgttgcgccct
gatgtaattttggaactggcatggaaacataagattatggattttgccatgccctactta
atacaggtcttgcgtgaatacactaataaagttgataaattggagttgaacgaggctcag
cgcgaaaaggaagaagacaccactgaacataaaaatattatacaaatggagccgcaactt
atgataactgctgggccagcaatgggcattccggctcaatatgcacagaattatccgcct
ggcgctgctacagttgctgctgcgacgacaacagggcgcaatatgggctatccatatttg
tag

DBGET integrated database retrieval system