KEGG   Drosophila persimilis: Dper_GL12043Help
Entry
Dper_GL12043      CDS       T01063                                 

Definition
(RefSeq) GL12043 gene product from transcript GL12043-RA
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dpe  Drosophila persimilis
Pathway
dpe00040  Pentose and glucuronate interconversions
dpe00053  Ascorbate and aldarate metabolism
dpe00830  Retinol metabolism
dpe00860  Porphyrin and chlorophyll metabolism
dpe00980  Metabolism of xenobiotics by cytochrome P450
dpe00982  Drug metabolism - cytochrome P450
dpe00983  Drug metabolism - other enzymes
dpe01100  Metabolic pathways
Module
dpe_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dper_GL12043
   00053 Ascorbate and aldarate metabolism
    Dper_GL12043
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dper_GL12043
   00860 Porphyrin and chlorophyll metabolism
    Dper_GL12043
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dper_GL12043
   00982 Drug metabolism - cytochrome P450
    Dper_GL12043
   00983 Drug metabolism - other enzymes
    Dper_GL12043
Enzymes [BR:dpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dper_GL12043
Glycosyltransferases [BR:dpe01003]
 Others
  Hydrophobic molecule
   Dper_GL12043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 6594480
NCBI-ProteinID: XP_002019746
FlyBase: FBgn0149651
UniProt: B4GLF6
AA seq 533 aa AA seqDB search
MRTPCCLLALGLGLFLLLSVGAADERVQSSKILAVFPFTGRSQYIFAEQYLKELARRGHN
VTVINTFGSDKNEPNFRVIGATKIHELMAAFAAAGFSQPAGQWKMLSMTTEFLNMLTANV
LEDAAVKALLESRETFDLLIMETVQNEALFGLGQHFGALTIGISSYGTDRHIDELMGNIS
PLSYNPMLLSSRTEQMSYEERLWNVWEAAVVWLHKRLVHLPTQRQLYGKYFPQAQQSLEQ
VMDSFSLMLLGQHFSLSYPRPYLPNMIEVGGLHLEQQRTVQPLPADIAEFVEQSPHGVIY
FSMGSNIKSADLPPSTRKVLMETLGALPQRVLWKFEADQLEDKPENVFISKWFPQPDILA
HPNVKLFITHGGLLSTIESIFFGKPVLGLPVFYDQHLNVQRAKQAGYGLAANLWGSNSTE
LQSLIHELLDNPSYAEAAQIKSKLYRDQKETALERAVWWTEYVLRHEGAAHLRCASRQLN
FVQLHGLDTWGVLGAVAVLSLLVILFVLKLLIEALCYVISKRRRGTENKLKEQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgagaactccctgctgtttgctggccctgggcctggggctgtttctgctgctcagtgtg
ggggcggctgatgagagggtccaaagctcaaagattttggccgtatttccatttactggc
cgatcgcagtatatattcgccgagcagtatctcaaggagctggcgcgacgaggtcataat
gtgacggtaatcaacacttttggcagcgataaaaacgagcccaactttcgtgtgattggt
gccacaaagatacacgaattgatggcagcctttgctgctgctggtttcagccaaccggct
ggacagtggaaaatgctgtccatgaccacggaattcctcaatatgctcaccgccaatgtc
ctggaggatgcggctgtcaaggcccttctggagagccgtgagacctttgatctgctgatc
atggagacggtgcagaacgaggccctgtttggtttgggccagcacttcggtgccctcacc
attggcatctcatcgtacggcaccgatcgacatatcgacgagctgatgggcaatatatcc
cctctgtcctacaatcccatgctgctgtcatcgcgcaccgagcagatgagctacgaggag
cggctgtggaatgtgtgggaggctgctgtcgtgtggctgcacaagcgattggttcatctg
cccacccagaggcagctctacgggaagtacttcccccaggcccagcagtcgttggagcag
gtcatggacagcttctcgctgatgctgctgggccaacacttcagcttgagctatccccga
ccctatctgcccaacatgatcgaggtgggaggtctccacctcgaacaacagcgaacggtg
cagcccctgcccgctgacattgccgaatttgtggagcagtccccccacggcgtcatctac
ttctccatgggatcgaacatcaagagtgccgacctgccgccctctacacgcaaggtcctg
atggagaccctgggcgccctgccgcagcgagtgctgtggaaattcgaggcggatcaactg
gaggacaagccggagaatgtgttcatcagcaagtggttcccccagccggatattctggcc
catcccaatgtgaagctgttcatcacccacgggggcctgctcagcaccatcgagagcatc
ttcttcggcaagcccgtactgggtctacccgtgttctacgaccagcatctgaatgtgcag
cgggccaagcaggcgggctacggcctggctgccaatctctggggcagcaacagcacggag
ctgcagtctctgatccacgagctgctcgacaatccctcgtacgcggaggcggcgcagatc
aagtccaagctgtaccgcgatcagaaggagactgccttggagcgtgccgtctggtggaca
gagtacgtgctgcgtcacgagggcgccgcacacttgagatgcgcctcacgacagttgaac
tttgtccagctccacggcttggatacatggggtgtgcttggggctgtcgctgttctatca
ctgctcgtcattttgtttgtgcttaagcttttaatagaagctttgtgttatgtcatctcc
aaacgtcgtcgtgggacagagaacaaattaaaggaacagtag

DBGET integrated database retrieval system