KEGG   Drosophila persimilis: Dper_GL12044Help
Entry
Dper_GL12044      CDS       T01063                                 

Definition
(RefSeq) GL12044 gene product from transcript GL12044-RA
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dpe  Drosophila persimilis
Pathway
dpe00040  Pentose and glucuronate interconversions
dpe00053  Ascorbate and aldarate metabolism
dpe00830  Retinol metabolism
dpe00860  Porphyrin and chlorophyll metabolism
dpe00980  Metabolism of xenobiotics by cytochrome P450
dpe00982  Drug metabolism - cytochrome P450
dpe00983  Drug metabolism - other enzymes
dpe01100  Metabolic pathways
Module
dpe_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dper_GL12044
   00053 Ascorbate and aldarate metabolism
    Dper_GL12044
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dper_GL12044
   00860 Porphyrin and chlorophyll metabolism
    Dper_GL12044
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dper_GL12044
   00982 Drug metabolism - cytochrome P450
    Dper_GL12044
   00983 Drug metabolism - other enzymes
    Dper_GL12044
Enzymes [BR:dpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dper_GL12044
Glycosyltransferases [BR:dpe01003]
 Others
  Hydrophobic molecule
   Dper_GL12044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C TT_ORF1 Glyco_trans_1_3
Motif
Other DBs
NCBI-GeneID: 6594479
NCBI-ProteinID: XP_002019745
FlyBase: FBgn0149652
UniProt: B4GLF5
AA seq 524 aa AA seqDB search
MLALRQALISLLVLWPIYSLEAARILAIFPFPGPSQYINVVPYLKALAARGHEVTSINAF
PQKKPLHNFRDIPVLEVFNNYDEIITDLGDPMNLWEENDFINKFFVDITRAVFLNKEVQE
TLLPPGKDHYDLIIVEALRSDAYYGFAAHFNAPIIGVSTFGADWNIDELVGNTSPFSYIP
LQTTGFTDRMTFRQRLTNIVDTAIAWLNYNLVHMPKQVEIYEKYLPEAAARVPLNELNRN
FSLVLLNQHFSLSFPRPYVPNMIEVGGLHISHKPAPLPKNIDEFIQGSGEAGVIYFSLGS
NVKSKDLPAETRETILKTFASLPQRVLWKFEVDQLPGKPPNVFISKWFPQPDILAHPKVK
LFITHGGLLSTIESIHHGKPVLGLPFFYDQFLNVERARQAGFGLSLDHKSLTQQDFKHTI
ERLLKEPQFADKARQMSARYRDQPMSPQETAVWWTEYVLRHKGAPHMRVAGQDLNFLAYH
SIDVIATLLGGALLGLILVVFVLWKLAKFCQGFGQSKTKKQKNQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttggctttgcggcaggcgctgataagtctactggtgctgtggcctatctacagcctg
gaggcagctcgtatactggcgatattcccctttccgggtccctcgcagtacatcaatgta
gtgccgtatctgaaggcattggcagcgcgcggtcacgaggtgacctccatcaatgccttt
ccccagaagaaacccctacacaactttcgcgatatcccagtgctggaagtgtttaacaac
tatgacgaaatcatcaccgaccttggcgatcccatgaatctctgggaggagaatgatttc
attaacaaattctttgtggacataacacgcgctgtattcctgaataaggaggtgcaggag
acacttttacccccgggaaaggatcactacgatttgattattgtggaggctctacgatcg
gatgcgtactatggctttgcggcacactttaatgcccccatcattggggtgtcgacgttc
ggggctgactggaatatcgatgagctggtggggaatacctcgcccttttcgtatattccc
ctgcagacgacgggctttacggatcgcatgaccttccggcaacgtctcaccaacattgtg
gatacagcgattgcctggctcaactataacctcgtgcatatgcccaaacaagtggagatc
tacgagaagtacctccccgaagcggcagccagggttcctctcaacgagttgaaccgaaac
ttctccttggtgctgctcaatcagcacttttcgctgagctttccccgtccgtatgtgccc
aacatgatcgaggtgggaggactgcacatatcccacaagccagcgccattgcccaagaac
attgacgaattcattcagggctcgggcgaggcaggagtcatatacttctccctgggatcg
aatgtgaagagcaaggatctgccagccgaaacgcgtgaaacgatactgaaaacatttgcc
agcctgccgcagcgggtcctgtggaaatttgaggtcgaccagctccctggaaagccaccg
aatgttttcatcagcaagtggttcccccagccagatatcctggcccatcccaaggtcaag
ctgttcatcacacacggcggactgctgagcaccatcgagagcatacatcacggaaagcct
gtgctgggtctgcctttcttctacgatcagttcttgaatgtggagcgtgccaggcaggcg
ggcttcggcctgagcctcgatcacaagtccctgactcagcaggacttcaaacataccatc
gagcgcctgctcaaggagccacagtttgcggacaaggcccgccagatgtcggcccgctat
cgtgatcagccgatgagtccccaggagacggccgtctggtggacagagtacgtcctgcgg
cacaagggtgccccgcatatgcgtgtggccggccaggacctgaacttcctggcatatcac
agcatcgacgttatagcaacgctcctgggcggtgctctcttgggcttgatcctggtggtg
tttgttctctggaagttggctaagttttgccaaggttttggtcaatcaaagacgaaaaag
caaaagaatcagtga

DBGET integrated database retrieval system