KEGG   Drosophila persimilis: Dper_GL12603Help
Entry
Dper_GL12603      CDS       T01063                                 

Definition
GL12603 gene product from transcript GL12603-RA
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
dpe  Drosophila persimilis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dper_GL12603
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dper_GL12603
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dper_GL12603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 901 aa AA seqDB search
MSQLKKLHMTNSLSSLEKLSDITKDLRNINIKLLLSTARKLFMKAEQYRLEGDEEMAYIN
YMKYFNIIKAIRSKPDYTTHKVQVRESLGDTEANRRIMDSLEMIADSLCERYRQLHKPPS
PAAPLNQTETISHSKPQGAASPHATEYARLGVVSCEELYQRISEKSVLVMDCRPSADYER
SHLTYFCAFNVPEELITPGMSAGKLQARLSSTAKASWASRSVKESVVLMDWNSKDAQPAA
NTPIATLLDILKNWDPDVTYRAPIQIVDGGYEYFIMMYPTHCTNPSVQAPKQNNNDMETI
DDIEYPSINDISMKEDISPRDFSPRPDINRASKQAALRTYQQAKPIAEIMREQAEFLQRA
QQNDEQLNSAAKMWKLLIQRKSPSSNFSESDNQLLYKILQLESQAEDYKIENNRLRNDVE
RLKTFQTVAPQQVTPKDAEATRRIELGILERQRLDEQNMRERQEREHQLAIAREAKKHYR
SPSPPPSPPEESSPQDEVSLSLNKPATNGVHDLDLSMKEILDEKPMFDRATKPTASPSNV
ERIVSRSRDFSPVIGHNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEYCLSDKYKNYI
SRSNKTNGQVIEEVAALIKELWNGQYKCVASRDLRSVVGQYQNIFRGVDQQDSHEFLTIL
MDWLHSDLQTLDVSRMRETIGAAEQAWLDFTKAKESIILHLFYGQMKSTVKCVTCNKESA
TYECFSNLSLELPPNANECQLNQCMDMYFSGERIQGWNCPNCKTKRAAIKKLDISKLPPV
LVVHLKRFYADTSNTGSYAKKQNFLSFPLQNLEMSPYIARAESRAAKPKTYQLYAVSNHY
GTMEGGHYTAFCKSPNYGRWYKFDDQVVSTLDTSNVISSAAYILFYTWLPPDTHARCFDD
V
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagttgaagaaattgcacatgacgaacagccttagtagcttggagaagctgtcc
gacataacgaaagacttgcggaacataaacataaaattattgctctccactgctcgcaaa
ctcttcatgaaggcggagcagtatcgactggaaggcgacgaggagatggcctacatcaac
tacatgaagtacttcaatataataaaggccattcgcagcaagcctgactatacgacgcat
aaggtgcaggtacgtgagtcgctgggcgacaccgaagcgaaccgtcgtattatggactct
ctcgagatgatagcggactcgctctgcgaacgctacagacagctacataagccgccaagc
cctgcagccccgcttaaccagacagagacaatcagccacagcaaaccgcagggcgccgcg
tccccacatgccacagagtatgctcgattgggcgtggtctcgtgcgaggagctgtaccag
cgtatttctgagaaatccgtgctggtaatggactgtcgacccagtgccgactacgagagg
tcgcacctcacctacttctgtgcattcaatgtgcctgaagagctcataacgccaggtatg
tcagctggcaaactgcaggctcgtctcagcagcaccgccaaggcctcgtgggcgtcgcgc
tctgtcaaggaatcggtggttctgatggactggaacagcaaggatgcccagccggcggca
aatactccgatagccacgctcctggacatcctgaaaaattgggatcccgatgtcacctac
cgcgcgcccatacagatcgtggatgggggctatgagtacttcatcatgatgtacccgacg
cactgcaccaatcccagtgtgcaggcaccgaagcagaacaacaacgacatggaaaccatt
gacgacatcgagtatccgtcgatcaatgacatttcaatgaaggaagacatcagcccgcgg
gattttagccctcgtccggacatcaatcgggccagcaagcaggccgcactacgcacctac
cagcaggccaagcccatagccgagatcatgcgcgaacaggccgagttcctacagcgggca
cagcaaaacgacgagcagctgaatagtgccgccaagatgtggaagctactcatccagcgg
aagagtccctcgagcaactttagcgaatcggataatcagctgctatacaaaatccttcag
ctggaaagccaagcagaggattataaaatagagaacaatcgcctgcgaaacgatgtcgag
cgcttgaagacgttccagacggtggcaccgcagcaggtgactcctaaggatgcggaggcc
accaggcgcatcgaattggggattttagagcgacaacggctggacgaacagaacatgcgc
gagcgccaggagcgggagcatcagctggccattgcacgtgaggccaagaagcattacagg
tcaccgtcgccaccgccttcaccgccagaagaatcctcaccccaggacgaggtgtctctt
tctctcaacaagccggctaccaatggggttcatgatttggatctgtccatgaaagagatt
ctggacgagaagcccatgttcgatcgggctacgaagccgacggcgagtccaagcaatgtg
gaaaggatagtgtcacggtctcgtgatttctcccctgttataggtcacaatgtgggaagg
ggtctcacgggattgaagaatctggggaacacctgctacatgaacagtatactgcagtgc
ctgagcaacacgccccagctgacggagtactgcctatcagacaaatacaagaactacatc
agccgcagcaacaagacaaatggccaggtcatcgaggaggtggcggccctcatcaaggag
ctctggaatggccaatacaagtgtgtggccagtcgggatctgaggtctgtggtggggcag
taccaaaatatctttcgcggcgttgatcagcaagactcgcatgagttcctcactattctg
atggattggctgcattctgatctgcagacgctggacgtgtcgcggatgcgggagaccatc
ggggctgcggagcaggcctggttggattttaccaaggccaaagagagcataattttgcat
ttattttatggccagatgaaaagcaccgtcaagtgtgtgacctgcaacaaggagtcggcc
acctacgagtgcttctcgaatctcagtctcgagctgccgcccaacgcgaacgagtgccaa
ctgaaccagtgcatggacatgtacttcagtggggagcgcatccaaggctggaattgtccg
aactgcaaaacgaagcgggctgccatcaagaagctggacatatcaaaactgccgccagtg
ctggtggtccatttaaagcgcttctatgcggatacgagcaacactggatcctatgccaaa
aagcaaaactttctgagctttccccttcaaaacctggagatgagtccgtatatagcacgt
gccgagtcgcgtgctgcaaagcccaagacgtaccagctgtatgctgtctcaaatcactat
ggtaccatggagggcggccactacacggcgttctgtaagagccccaattatgggcgctgg
tataagtttgacgatcaagtggtttcgacgctggacacgtcaaatgtcatctcgagtgcc
gcatacattctcttctacacctggctgccccccgatacgcatgcccgatgttttgatgac
gtataa

DBGET integrated database retrieval system