KEGG   Drosophila persimilis: Dper_GL12954Help
Entry
Dper_GL12954      CDS       T01063                                 

Definition
GL12954 gene product from transcript GL12954-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dpe  Drosophila persimilis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dpe00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dpe00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dpe00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dpe00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dpe00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dpe04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 617 aa AA seqDB search
MRFSGHNRYPCSTATAALALCVCLALGAGPSQGDDSAEAIGSGSRKWLCSQTDICTSEDD
MEDGAQYLEERFESQRDCRLSCGKYGSIWPMPTGEECSLSHERVHFDPWKVRFHVVAPSE
VTTQFLRETNRLFVSNLLKECTRNCTLASSKQILVRATVSSDSLVLDWRTDESYSMVLRT
TETATFVDIQAATVYGARHSFETLSNLVAGSVTNGLLLVSAARISDRPAFPHRGVLLDTS
RNFIPLRYLRSTLDAMAASKMNVLHWHVVDTHSFPLEITRVPEMQRYGAYSASQTYSRTD
SVNLVKYARLRGIRILIEIDGPSHAGNGWQWGPAAGLGNMSVCLNQSPWRRFCVQPPCGQ
LNPLNDHMYAVLKEILEDVAEMGAPEETVHMGGDEVFLPCWNNTEEIVTKMRAQGYDLSE
QSFLRLWSQFHQRNLNAWDDINERMYPNIKEPKPVILWSSHLTVPKYIETFLPKERFIIQ
TWVDSQDPLNRDLLQRXXXXXXXXXXXXXXXXXXWGSTSYYNWRTVYASGMPMGNHGNQV
LGGEVCMWSEFVDHNSLESRIWPRAGAAAERLWSNPKSSALVAQRRFYRYRERLLARGIH
ADAVIPRWCVLHEGRCL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcagcggccacaaccgttatccctgctcgacggcgacagcggcgctggcactc
tgcgtttgcttagcacttggcgcaggaccgtcgcagggcgacgacagcgccgaggcgatc
ggcagtggcagcagaaagtggctctgcagccaaacggacatctgtacgtccgaggatgat
atggaggatggggcgcagtatctggaggagcgattcgagagccaaagggactgccggctg
tcgtgcggcaagtatggatccatctggccgatgccgacgggggaggagtgcagcctgtcg
cacgagcgggtgcactttgatccgtggaaggtgcgcttccatgtggtggcccccagcgag
gtgaccacgcagttcctgcgcgagacgaaccgcctgtttgtgagcaatctgctcaaggag
tgcacccgcaactgcacattggccagcagcaagcagatcctcgtgcgggccactgtgagc
agtgacagcctcgtccttgattggcgcacggacgagagctactcgatggtgctccgcacc
acggagacggccaccttcgtggacatccaggcggcgacagtgtacggagcgaggcactcc
ttcgagacgctcagcaacctggtggcggggagcgtgaccaacggcctgctcctcgttagc
gccgcccgcatctccgatcgtcccgccttcccgcatcgcggcgtgctcctggacacctcg
cgcaacttcataccgctgcggtatctgcgcagcaccctcgacgccatggccgcctccaag
atgaacgtcctccattggcatgtggtggacacgcacagcttcccgcttgagatcacccgt
gtgccggagatgcagcgctacggcgcctactccgcctcgcagacctactcccgcacggat
tccgtcaatctggtgaagtatgcccgcctccggggcatccgcatcctcattgagatcgat
gggccctcgcacgcgggcaacgggtggcagtggggcccggcggcgggcctgggtaacatg
tccgtgtgcctgaatcagtcgccctggcggcgcttctgcgtgcagccgccgtgcggtcag
ctgaaccccctgaacgatcacatgtacgcggtgctgaaggagatcctcgaggatgtggcc
gagatgggggcaccagaggagaccgtgcacatgggcggcgacgaggtgtttctcccgtgc
tggaacaacacggaggagatcgtgacgaagatgcgggcccagggctacgatctcagcgag
cagagcttcctccggctgtggtcgcagttccatcagcggaatctgaacgcctgggacgac
atcaacgagcgcatgtatcccaacatcaaagagcccaagccagtgatcctctggtccagc
cacctgaccgttccgaaatacattgagaccttcctgcccaaggagcggttcatcatccag
acgtgggtcgactcccaggaccccctcaaccgggacctgctgcaacgcnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntggggcagcaccagctac
tacaactggcgcacagtctacgccagcggcatgccgatgggcaatcacgggaaccaggtc
ctcggcggcgaggtgtgcatgtggagcgagtttgtcgatcacaactccttggagtcccgc
atctggccacgagctggtgcggccgccgaacgcctctggtcgaatccaaagtcctcggct
ctggtcgcccagcgccgcttctatcgctatcgagagcgcctcctggcacgtggcatccat
gcggacgccgtcatcccacggtggtgtgtcctacatgaggggaggtgtctctag

DBGET integrated database retrieval system