KEGG   Drosophila persimilis: Dper_GL13032Help
Entry
Dper_GL13032      CDS       T01063                                 

Definition
GL13032 gene product from transcript GL13032-RA
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dpe  Drosophila persimilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dper_GL13032
Enzymes [BR:dpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dper_GL13032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 284 aa AA seqDB search
MTSRQRTVIIFKSESDSTDVYAETLLGHNFNPVFVPTLCFGFKNLQELGNKLQTPDKYAG
IIFHQSTAVNEALLLGELPGGWKLLHNYAVGEVTHNLALSTLQQLFTHGKQTGNARNLGE
YIVDTFDGSRDLPLLLPCGNLATDTLLSKLAENGFCVDACEVYETKCSPQLGECVERALK
EAGDSVEFLAFFSPSGVACAMEYFRAHNISLEPWKLVAIGPSTRRALESQGQKVYCTAER
PTVEHLVKVLLNPQDSRERLVREREQMQELERAAAAAAAALENN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacgagccgccagcggacggtgattattttcaaatcggaatcggatagcaccgatgtg
tacgcggagacgctgttggggcacaacttcaatccggtgttcgtgccgacgctgtgcttc
ggcttcaagaacctgcaggagctgggcaacaagctacagacgccggacaaatacgcgggc
atcatctttcaccagtccacggccgtcaacgaggcgctgctgctgggcgaactgccaggt
ggttggaagctgttgcataactatgccgtcggcgaggtgacccacaacctggccctcagc
acgctgcagcagctcttcacgcacggcaagcagacggggaatgcccgcaacctgggcgag
tacattgtggacacgttcgatgggtcgcgcgatctgccgctgctgctgccgtgcggcaat
ctggccaccgacaccctgctctcgaagcttgccgagaacggcttctgtgtggacgcctgc
gaggtctacgaaacgaagtgtagcccccagctgggtgagtgcgtggaacgggcactgaag
gaggccggcgacagcgtcgaatttctggccttcttctcgccctcgggcgtcgcctgtgcc
atggagtacttccgggcgcacaacatttcgctggaaccgtggaagctggtggccatcggg
ccgagtacacggcgtgccctggagtcgcagggccagaaggtctactgtaccgcggagcgg
ccgacggtggagcatctggtgaaggtgctgctcaatccgcaggacagcagggagcggctg
gtgcgtgagcgggagcagatgcaggagctcgaacgggctgcggccgccgccgccgctgcc
ctggaaaacaattag

DBGET integrated database retrieval system