KEGG   Drosophila persimilis: Dper_GL13067Help
Entry
Dper_GL13067      CDS       T01063                                 

Definition
GL13067 gene product from transcript GL13067-RA
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
dpe  Drosophila persimilis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dpe03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2088 aa AA seqDB search
MDGMTEDMWTPCKHLYGTLQQAIAQPKDLIGDLEQCLKKNKHNFTNFLRNPPKNEKSRNQ
IRAGLTEGIPLGAQGHKLILSQDLIDEAIILSDMFDLDELIAVELLYTAQRQQMHHPGLP
RGLVAVLLYYDGRKAMACALRDLMQTMSGVSWVTELPREFLSLVNNYVQNLTEESNLLSR
LLDILAEMDVVKENLMLTKNRAFGSTKHQNQVLALYEDIRKAVAMSLFNYSAQRGLPRGN
AIRLMKMLAACKCNDNAGGNIDDVTVIMLMALLYSYDTSVLLSSDVVNPYTGRLPIMWDP
EFAKSFHEALYAQAKWQMPRLDAIIKYSFALALASLRHAPSQMQAAASALIPRDEQLMDE
ALASNVLGFIYRQLLENEMIYNTEFIYRRAHLLITDFIDFMHAKVAELRNRADESARTVI
SFLNEGLEPPPNLDANFELLMLCVSRLYGDRRASHTLCNEYWGASDTATSAGSGGGGGGG
SGSGNGNNAGLYPMNNTRAVSLFKFISLASELLPQTLFKSYLKMITGLTRTELSARSAFN
LLKNTPSGSSSFSMGWDHFFQALASYYSNMRTDAFSAMAPGSASNGDLFMRRALQPRNIT
QRETEHLVAVMGIMRAVAEHDRVSRVMMCDQASWQAPQVLLGLVACATPLALKAEIMFTL
AALAKSKETARAIWFQLEDSQIIPTVVTTAAAGQSPCSLAEEIEQNESRLESYNLSRGVL
QLLHTLMTTHMPRSLGAGPRHPGYDPYFNFLMDSIILRVYNRTYKDPSEMWEVAAKGLKL
LFYLLATYRPKASDFMELRDEHPYPGYHVMLQLQVKSHLLQLLLRIIEDTRERLDEYRRF
RGKEQLEECALYALLLLEVAVAKQNAFFEAHSSANSPILLSGLNRMLLDINPRTRRPDYV
VKIIKFVTYNNWLPRHSLAAIKILSAVTMLPNVPSQILNMYALGSNEKLEVRQGFVECLE
MDARLAQKNEELLDSIVLNDYQAMGDVLHHGGHQPPSVAVDEDESEADITGPEDGDTTLG
PCYEVVALNEKMPVGIDLQIKEAVVELFGLNLCQAPPNFVYFLLGIDVLRDFMARDKQQV
GIEMQCCCVHSLVLVLEKYLESQRHSQEKYCPYTAHLVERVYQLFQGLCANRRTSETILR
FFRLTCNDFLLRHLSAMPFRRHREDHMLHAMSHLLNCVAVEVRLAANHGQMTRYNLLCDI
LLLGGQSDGLRANPGMPQDLNNDILSGTASASFYGLDVGPVAAAVKIPAMPDKTQGLHAN
RLLECLVLEVNATAPQPQLEFFDPVLTTTVLKECEARPRQSPGSDSKSGTASGSEPYLMI
NIRKLHDVLHEELRTVQSTIATGQRKAISGEITVLLQYAVEVNRVRTQRIATLRFVEAWC
QLVQILFSSMPEVLLPPALRRQYIIDIIEKMLLKVEPVQPLIEISIEITETILLLLANLR
ICYYQLEDQRTSDDSDVAAAQNGDNSLVNGPLSLSYSHAHSQSNLSGTMTGSTSNLRFIL
KRIVEWIMVSGVKSQKLRINLYTALLNCLRIVKRLRTEEEVDFHESIASRLEKSQKAVSD
QRHEDKDRLKEMAAEVIGVYGEKLIDSICHDAVTGHDVCRMLALACLEMISELDAVSTLT
EFVVSRGYLKHLLDNVAESDDALSAILQPVPDNLRQLYVYEARLAFLTRLSQTGARMLLA
EGALGVLSNMRVYDLQPDLKANQLRKDPEGFLPNTYKRFHSILQPALALCDGIVSSLGSQ
NDSAAHQVLNFLFAHMDMVETMLRTATPLMDLGHLQQLASITNLFSRTSTPELCTNMADS
YVQERDLEFYNRLNRLQQLMIVVFGRFTVTEATIRQILQQEDVESLPESQKSRHVKYFLD
IAANLSLYCRHAVTSHVRDSTTSKFLLTTIVNDVTPLTGRTDGKKLTAIMHTIIEQLKGS
VGYYHSQKSHADNLLEQRSSLPNICFGPSGKESYVELSQRHKEKRNELMQAVFIAEQNLY
LLWIHLDFYMRNAVIFASENRSAINESNLESSSGNDSVSVLHATPDEILQLKQHLISTFN
ETFCSELIVASEEYSVKCKGFNGSLLRRIKALVQFAASNGNANESSFI
NT seq 6267 nt NT seq  +upstreamnt  +downstreamnt
atggatggcatgaccgaggacatgtggacgccatgcaagcatctttatggcacactgcag
caggcgattgcccagccaaaggatctcattggcgatctggagcagtgcctcaagaagaac
aaacataactttaccaattttctacgcaacccgcccaagaatgagaaaagccgaaatcag
ataagggccggactcacggaaggcataccactgggcgcccagggccacaagctgatactg
tctcaggatctgatcgatgaggccatcatattgtcggacatgttcgatctggatgagctg
atcgccgtggagctgctgtacacggcccagcgtcagcagatgcatcatccggggctgccc
cgtggcctggttgccgttttgctctactatgatggccgcaaggccatggcctgtgccctg
cgcgatctgatgcagacgatgagtggcgtgtcctgggtgacagagctgcccagagagttc
ctttcgttggtgaataattatgtgcagaatctgacggaggaatcgaatttgttgtcccgc
ctgctggatatactcgccgaaatggatgtggtcaaggagaaccttatgctgaccaaaaat
cgcgcctttggctccacaaagcatcagaatcaagtgctggccttgtacgaggacatccgc
aaggctgtggccatgagcctcttcaattattcggcccaacgtggcctgccccgcggcaat
gccatacgtctgatgaaaatgctcgcggcatgcaaatgcaacgacaatgcaggcggcaat
atcgatgatgtgacagtcattatgctgatggctctgctgtactcctatgatacgtccgtg
ctgctgagctcggatgtggttaatccatacacgggccggttgcccatcatgtgggatcca
gagtttgccaagagcttccacgaggccttgtacgcccaggccaaatggcagatgccgcgc
ctcgatgccatcatcaagtacagctttgccctggccctggccagcctgcggcatgcgccc
agccagatgcaggcggccgccagtgcgctgataccacgcgatgagcagctaatggatgag
gcactggcctccaatgtccttggtttcatataccgtcagttgctggagaatgaaatgatt
tacaacacggagttcatttatcgacgggcgcatctactgatcaccgatttcattgatttc
atgcatgccaaagtggccgagctgcgcaaccgggcggacgagtccgcgcgcacggtgatt
agtttcctgaatgaaggcctcgagccgccaccaaatctggacgcaaacttcgagctgcta
atgctgtgcgtgtcccgtctctacggcgatcgacgggccagccacaccctgtgcaacgag
tattggggggccagcgacacggccacatcagccggcagcggcggcggcggcggcggcggc
agcggcagcggcaacggcaacaatgccggcctctatcccatgaacaacacccgggctgtg
tccctattcaagtttatatccttggccagcgaactgctgccacagacgctgttcaagtcg
tacctgaagatgatcacgggcctcacgcgcaccgagctgtcggcccgcagtgccttcaat
ctgctcaagaacacgccgtcgggttcctcgagcttttcgatgggctgggaccacttcttt
caggcattggccagctactacagcaacatgcgcacggatgccttcagcgctatggccccg
ggcagtgcctcgaatggcgatcttttcatgcggcgagccctgcagccccggaacataact
cagcgcgaaacggagcatctggtggctgtgatggggattatgcgcgcggtggccgagcac
gatcgcgtgtcccgggtgatgatgtgcgatcaggccagctggcaggcgccacaggtgctg
ctgggcctggtggcatgtgccacaccgctggccctcaaggcagagatcatgtttacgctg
gcagccttggccaagtccaaggagacggcgcgtgccatttggttccagctggaggactcg
cagataatacccacggtggtgacgacggcagcggccggacagagcccgtgcagcctggcc
gaggagatcgagcagaacgagagccgtctcgagtcgtacaatttgagtcgcggcgttctc
cagctgctccacacactgatgaccacccatatgcccaggagcttgggcgccggcccgcgg
caccctggctacgatccgtatttcaatttcctgatggactccataatcctcagggtctac
aatcgcacgtacaaggaccccagcgaaatgtgggaggtggccgcaaagggattgaagctt
ttattctatctgctggccacgtaccggccgaaggccagcgattttatggaattgcgcgac
gagcatccgtatccgggctaccatgtgatgctgcagctgcaggtgaaatcgcatctattg
cagctcctgttgcgcatcatcgaggatacccgcgagcggctggacgagtacaggcgcttt
cgtggcaaggaacagctggaggagtgcgccctgtacgccctactgctgctcgaggtggcg
gtggccaaacagaatgccttcttcgaggcccactcgtccgccaatagtcccattctgctg
tcgggactgaaccggatgctgttggacatcaatccgcgcacccgacgacccgattacgtg
gtgaaaatcattaagtttgtgacctacaacaattggctgccgcgtcactcgctggcggcc
atcaagatactgagcgcggtgaccatgctgccgaacgtcccctcacagatcctcaatatg
tatgccctcggcagcaacgagaagctcgaggtgcgccaggggtttgtcgagtgcctggaa
atggacgcccgtttggcccaaaagaacgaagagctcctcgattcgattgtgctcaacgac
tatcaggccatgggcgatgtgctccaccacggagggcatcagccgccgagtgtggccgtc
gacgaggatgaatcggaggcggacatcaccggtcccgaggacggggacaccaccttgggc
ccatgctacgaagtggtggccctcaatgagaagatgcccgtcggcattgatctgcagatc
aaagaggctgtggtcgagctctttggactcaatctgtgtcaagcgccgccgaatttcgtt
tactttctgctgggcatcgatgtcctcagggactttatggccagggataagcagcaggtc
ggcattgaaatgcagtgctgttgtgtgcattccttggttttggtcctggaaaagtatctc
gagagccaacggcacagccaggagaaatactgcccctatacggcccatctggtggagaga
gtctatcagctgttccagggcctgtgcgccaatcgtcggacttcggagaccatcctgcgc
ttctttcgcttgacctgcaatgacttcctgctgcgccatctgagcgccatgccgtttcgc
cgccaccgcgaggatcatatgctgcacgccatgagccatttgctcaattgtgtggccgtc
gaggtgcgcctggcggccaatcatggccagatgacgcgctacaatctgttgtgcgacata
ctcctgctgggcggccagtcggatgggctgcgtgcgaatcccggcatgccgcaggacctc
aacaacgacatactgagtggcacagcctccgccagcttctatggcctggacgtgggcccc
gtcgcggcggccgttaagatacccgcgatgcccgataagacccaaggactgcatgcgaat
cgtttgctggaatgtctggtgctcgaggtgaatgccacagcgccccagccgcagctggag
ttcttcgatccggtgctgacgacaacggtgctcaaggaatgcgaggcccgcccccgacag
agtccaggcagcgacagtaagagcggaactgcctcgggctctgagccatacctgatgata
aacatccgcaaactccacgacgtcctgcacgaagagctgcgtacggtgcagagcaccatt
gccacgggccagcgcaaggccatcagtggggagatcaccgtgctgctgcagtacgccgtc
gaggtgaaccgtgtgcggacacagcgcatcgccacgctgaggtttgtggaggcgtggtgc
cagctggtgcagatactgttcagcagcatgcccgaggtcctgctgccgccggccctgagg
cgtcagtacatcattgatatcatcgagaagatgctgctgaaggtggagcccgtgcagccg
ctaatcgagatctccatagagatcaccgaaacgatcctgctgctgctggccaatctgcgc
atctgctattaccagctggaggatcagcggaccagcgatgatagcgatgtggccgccgcc
caaaacggcgacaacagcctggtcaacggcccgctctccctttcgtattcgcacgcccat
tcgcagtcgaacctcagcggcacaatgacgggcagcacgagcaatctgcgcttcatcctg
aaacgcatcgtcgagtggatcatggtgagcggcgtcaagtcgcagaagctgcgcatcaat
ctctatacggctttgctcaattgcctgcggatcgtgaagcgtctgcgcaccgaagaggag
gtggactttcatgaaagcattgcctcgcgcctggagaaatcgcaaaaggccgtctccgat
cagcggcacgaggataaggaccggctcaaggagatggccgcggaggtgatcggggtctat
ggggagaagctgattgattcgatctgccacgatgcggtgaccggacacgatgtgtgccgc
atgctggcgctggcctgcctggagatgatctctgaactggatgcggtgagcacgctcacc
gaatttgtggtgtcgcgcggctacctgaagcacctgctggacaacgtcgcagaatcggac
gatgccctgagcgcgatcctgcaaccggtgccggacaatctgcggcagttgtacgtgtac
gaggcgcgtttggccttcctcacgcgactgtcgcagacgggtgcccgcatgttgctcgcc
gaaggagccctgggcgtcctgtccaatatgcgggtgtacgacctgcagccggacctgaaa
gccaaccagttgcgaaaagatccggagggctttctcccgaacacgtataagcgtttccat
tccatcctgcagccggccctggccctttgcgatggcattgtcagctccctgggatcgcag
aacgattcggccgcccaccaggtgctcaactttctgttcgcccacatggacatggtcgag
acgatgctgcgcacggccacgcccctgatggacctggggcacctgcagcagctggcgtcg
atcacgaatctattctcgcgcacctccacgcccgaactgtgcaccaatatggctgatagc
tacgtgcaggagcgcgatctggagttctataatcgcctgaatcgcttgcagcagctgatg
atcgtggtctttggccgtttcactgtgaccgaggccaccattcgccaaatactccagcag
gaggatgtggagtccctgcccgagagccagaagagtcgtcacgtcaagtatttcctggac
attgccgccaatctgtcgctctattgccgccatgcggtgaccagtcatgtccgcgacagc
accacctccaagtttctcctaacgacgatagtcaatgatgttacaccactgactggcagg
acagacggcaagaagctgacggccattatgcacacaatcatcgaacagctgaagggctcc
gtgggctactaccattcgcagaagtcgcatgccgacaacctgctggagcagcgctcctcg
ctgccaaacatctgcttcggcccgagcggtaaagaaagctacgtggagctcagccagcgg
cacaaggagaagcgcaacgaactgatgcaagccgtctttatagccgaacagaatctgtat
ttgctgtggattcacttggacttttatatgcgtaatgcggtgatatttgccagcgagaat
cgcagtgccatcaacgagagcaatctggagagttccagcggcaacgacagcgtctccgtg
ctgcatgccacccccgatgaaatccttcagctgaagcagcatctgatctccacctttaac
gagactttctgctcggagctgatcgtcgccagtgaagagtattcggtcaagtgcaagggc
ttcaatggttcactgttgcgacgcatcaaggcgttggtgcagtttgctgcctccaatggg
aatgccaacgagagttctttcatatag

DBGET integrated database retrieval system