KEGG   Drosophila persimilis: Dper_GL13296Help
Entry
Dper_GL13296      CDS       T01063                                 

Definition
GL13296 gene product from transcript GL13296-RA
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dper_GL13296
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dper_GL13296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 820 aa AA seqDB search
MLDVKKNRGFHKTPSSRLQRGGEPAVVAVAAPSAAAAAGASTVAASHPGAGKAATATGTT
SVASGKGAGGSKRGIHNSTARGREGKSKYSTGPGIPTGGGASVGVGKGQGKHGSSSAAGA
AGGGGGRSVTTGTAGGNPVRTANQRYFLVPSFKDPTFLKEECELAHAQVTGAGAGKSKAT
HGKQRCRVGEDNKNNNNQHSSHNSHQNHNNHSSHKAQGHVAGGGLGPQGALNDMPRPPIN
ARWYGIDSVSIKASIEKFNNLSCQKQRQGQHSGKETTTGYSTSPAGGARGAMPRSTHIAQ
TSSIGSSGNLQQHRYSGDLDNVRLSAGHSSSLTRAAYRTTAPMNCVVAPLPRAVQPVLVA
FNPQVNDSKTQSTTAAATTTLATTTSATSATSGTVSASASGSSSSVSTATGTVTVTVTGS
AAASDSARNVVSTRNVLPPVSPTPSRYWERDSSNTTSRQYSSSNSSALSGSSKYNTDEGY
RSSATQREEKSEGLCGLRNIGNTCFMNSVIQCLSHTTELTRFLRTHHGSRSSATKDQLIL
FEFAKLIQEMWTSSVHTVTPMDLKRAFSAKHRMYSDYNQQDAQEFLRFFLDSLHSALNSG
IKGETLNIDDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPF
WDLSVPLPSSSRCKLEACLDLFIREEILDGDEMPTCSKCKTRRKCTKSFTIQRFPKYLVI
HLKRFSETRWSKLSNIVEFPTADRDLNMASYGANSNSNVHYSLYAISNHMGSTAGGHYTA
LCKHPVSRKWHEFNDNIVSDSVSENFLVSSSAYILFYERT
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgttaagaagaacagaggtttccacaagactccatcatccagactgcaacgc
ggaggtgagccagcagtagtagcagtagcagccccttccgcagcagcagcggcaggtgca
tctacagtagctgcatcccatccgggagcaggaaaggcagcaaccgccactggtaccaca
tcagtggcatccggcaaaggagcaggcggctccaagcgaggcatccataatagcacggca
cggggccgggagggtaaatcgaaatactccaccggaccaggaatcccaaccggaggaggt
gcttcagtgggagtgggcaaggggcaaggtaaacacggctcatcatcagcagcaggagcg
gcaggaggaggaggtggccgctcagtgacgacgggaacagcgggcggaaatcccgtgcgg
acggccaatcagcgctacttcctcgtgcccagctttaaggaccccacattcctcaaggaa
gagtgcgagctggcccatgcccaggtgacgggtgctggtgcgggcaagtccaaagccacc
cacggcaagcagcgctgtagggtgggtgaggataacaaaaacaataataaccagcacagc
agtcataacagccaccagaaccacaacaaccacagcagccacaaggcacagggccatgtg
gcaggtggtggactaggaccacaaggagcattgaatgacatgccgcgtccgccgatcaat
gcacgttggtatggcatcgattcagttagcattaaagcctcgattgaaaaattcaacaat
ctcagctgccagaagcagcgtcaggggcaacattcgggcaaggagacgacaactggctac
tccacgtctcccgccggaggagccagaggagccatgccacgaagtactcacatagcgcag
acctcgtccatcgggagcagtggaaatctgcagcagcatcgctacagcggcgacctggat
aatgttcgtttatcggcgggccatagcagctccctaacgcgggccgcctaccgaaccacg
gcccccatgaactgtgtcgtcgctccgttgccgcgagcagtgcagcccgtcctagtggcg
ttcaatccacaggtaaacgactctaagacacaatcaaccactgcagcggccacaacaaca
ctagctacaaccacatccgccacatcagccacatcgggcactgtttccgcttccgcctcc
ggttcgtcgtcttccgtctccacagccacgggcacggtcacggtcacagtcacgggctcg
gcggcagccagcgatagtgccaggaacgtcgtcagcacacggaacgtcctgccgcccgtg
tcgccaacacccagccgctactgggaacgggacagcagcaacaccaccagtcgccagtac
tcctcttccaactcctcagctctgagcggcagcagcaagtacaacaccgacgagggctac
cggagctcggcgacgcagcgcgaagagaaatcggaaggtctgtgcggcctgagaaacatc
ggcaacacctgtttcatgaactcggtcatccagtgcctgagccacacgactgagctaacc
cgctttctgcgcacacaccatggctcgcgctcgtccgccaccaaagatcagctaatactc
ttcgaatttgccaaactcatacaggagatgtggacatcaagcgtgcacaccgtaaccccc
atggacctcaagcgggccttctctgccaagcatcgcatgtacagcgactacaatcagcag
gatgcgcaggagttcctgcgcttcttcctcgattcgctgcactcggccctcaactcgggc
atcaagggcgagaccctcaatattgacgataatctcagtgacaataagaaggccgatcta
acctgggagtggtatactcggcatgagaactccttggtacgcgatctctttgtgggacag
ctgaagagcactctgaagtgcacaacatgcggcaacacgagcgtgaccttcgatccattc
tgggacttgagcgtgccgctaccctcctcatcgcgctgcaagctagaggcctgtctggat
cttttcattcgcgaggagattctagatggcgacgagatgcccacatgctctaaatgcaag
acgcgccgaaaatgtaccaagagcttcaccattcagcgtttccccaaatatcttgtcata
catctgaaacgcttctcggaaacgcgctggagcaagctgtcgaacattgtcgagttcccc
actgctgaccgcgacctcaatatggcctcctatggcgcaaactcaaactcaaatgtgcat
tactctctctacgcgatatcgaatcatatgggatcaactgctggaggtcattatacggcc
ctttgcaagcatccagtttctcgcaagtggcacgagttcaatgacaacattgtgagcgat
tccgtttccgaaaactttctcgtttcatccagtgcttatatacttttctacgagcgtacg
taa

DBGET integrated database retrieval system