KEGG   Drosophila persimilis: Dper_GL13360Help
Entry
Dper_GL13360      CDS       T01063                                 

Definition
GL13360 gene product from transcript GL13360-RA
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
dpe  Drosophila persimilis
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dpe00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1497 aa AA seqDB search
MVVGSNHTRRGETGSRFTNSSSNSNGNSAASSTSSGSTSTTSSTSSLASSEAAALLSSMS
QKSQTAAQAPPTASSHHQLQQPTIATTTNHHQPHPHYQQQQSHNHHHHQQHQSSNGNGVG
GGAGVGGGGSGGGGGSLNGCNGSAVSRLSQSTGMSPRELSENDDLATSLILDPHLGFQTH
KMNIRFRPLKVDTQHLKAIVDDFIHGQNYDVAIQRIYDGPWIPRHLKNKNKIATKRLHDH
IVRYLRVFDKDSGFAIEACYRYSLEEQRGAKISSTKRWSKNEKIECLVGCIAELSETEEA
ALLHSGKNDFSVMYSCRKNCAQLWLGPAAYINHDCRANCKFLATGRDTACVKVLRDIEVG
EEITCFYGEDFFGDSNRYCECETCERRGMGAFAGKHNRHFDDATGLVLGLTSGLGLTNGG
AGNGGGYRLRETDNRINRIKSRANSTNSTSNSNSNTNDSTSTNDSSIASNGVATMAVPIS
QPAGQAVGGRGSGKEAGSVPPGSAAAAAAVSLMEKKLPNLVVSPLTMKELRQKGMTKYDA
EMIMANAAYQQQQHHHHHHHHQHFLHHHHNHGQHASTGAEATAAVQQLAMQKPGVLPVTC
TGAVVGVGQGACAAGGTITSSSTELNGRSNSLRKSIRVNSTSSSISTASTDEVVAANAPS
MPLPLPLTIPMSAKSAVVLVTRCKPAMAIAALHQRQQRQLRRSERQTNRGGQKEKSFGKY
ITDSESSDTDHQRSERQGMKVRGGEDQQPTKVFLMDGEQQQERRVTRNSAGRAAAAAAAA
ASAPASGGLGLLGLGRLATAHNSSNITAATATTTSTSSISSNKATTITNCNNHNSVDSSR
INHNSNLSGRHSVKSKKPPPSEASSIPTSTSSVDAQSLHQSQQQKATRRSNSPAHKKNLL
DTFNQAQQAYPPSHLLAEEDPPKQKRSRRAAALAAAQHIHCEAFGGQVGLGFGLGVGTRA
GPTATGSLRKRQQPASAGAATGVASEKASIRLSNSSSSIEPLLKTPERRLKLTLRMKRSP
ILDEVIELGTSFSDERHLARHNGAIGGRSAGVTGASFGSGGAVGSADVTGAEGIDIEYEI
LRMEGISEHGNDDDVDDDDDDDDDDDDDDDDDEDDDKDDNDDDDDDDDDDDDDDDDDDEE
EEDEDEDDDDDDDEDDNAEDLPEQDAEQPQVPLEAAPPSTIHYEPLSKKQKKKQRGCSSQ
RRSPDPSSSTSSMYVTPQKKRLRLIFGNESHTIDIPPTGEGACGAAEGGAEATGVDDLNS
SSGGVSASDDSFNASYASSGTSMTVNASSQMTTSNNSSGVGPVIPMSSGTGNVQTEGIDS
TAKLVAPAQTPQSPTSSTSGSFYSACTSTTNTPYFPKGERRGGAGTGPGEEATYINYYQS
SGSKVLGKYRAMKPITSSPGQGQAIVSSSSGSGVGAGHGFLPQSLTIPKHTFGTCALLAP
TSFASLQQPPPPSVQHHQQAKTSVATSTSASCSPPVHNHHHHSQQHQNPHHNHHIQQ
NT seq 4494 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcggctcgaatcacacgcggcgcggtgaaactggcagcagatttacgaacagc
agctccaacagcaacgggaacagcgccgccagcagcacaagcagtggctccacctctacc
accagctcaacgtcttcattagctagcagcgaggcggcggctcttttgtcgtcaatgtcc
caaaaaagccaaacggccgcccaagcaccacccacagcaagcagccaccatcagctgcag
caaccgacgatagcgacgacgacgaaccaccatcaaccccatccccattaccaacagcag
cagtcacacaaccaccaccaccatcagcagcatcaatcctcaaatggaaacggagtgggc
ggtggagcaggagtgggtggaggcggaagtggaggtggaggaggttctctcaatggctgt
aatggcagcgccgttagtcggctatcacagtccactgggatgtcaccgcgggaactctcg
gagaacgacgatctggcaacatcgctcatactggatccgcatcttggctttcaaacccac
aagatgaatatacgcttccgccctcttaaggttgacacgcagcatttgaaggcgatcgta
gatgacttcatccacggccagaactatgacgtggccatacagcgaatctacgatggcccc
tggataccgcgccacctgaagaacaagaacaagatcgccacaaagcggttgcacgaccac
attgtacgctacttgcgcgtatttgacaaggacagtgggttcgccattgaggcatgctac
cggtactccctggaggagcagcgcggggccaagatcagctccaccaaacgctggtccaaa
aacgaaaagatcgagtgcctggttggctgcattgccgagctaagcgagaccgaggaggcg
gccctcttgcactcgggcaaaaatgacttctctgtaatgtatagctgcagaaagaactgc
gcccaactctggctgggaccggcggcgtatatcaatcacgattgtcgggctaactgcaag
ttccttgccaccggacgcgacacggcctgcgtcaaggtgttgcgtgacatcgaggtgggc
gaggagatcacttgcttctatggtgaggacttcttcggggacagcaaccgctattgcgag
tgcgagacgtgcgagagacgtggaatgggagcctttgccggcaagcacaacagacatttt
gatgatgccactggcctggtgctaggtctgacctcgggcctggggctgaccaacggcggt
gctggcaacggtggcggctaccgtctccgcgaaaccgacaaccgcatcaatcgcatcaag
agtcgcgcgaactcgaccaacagcacttcgaatagcaacagcaacactaacgactccacc
agcaccaacgatagcagcatcgccagcaatggagtagccacaatggcagtccccatatcc
cagccagccggacaggctgtgggaggtcgtggatcgggcaaagaggcgggctctgtgcct
ccgggatctgcagcagcagccgcagccgtatccttgatggagaagaagctgccaaatttg
gtcgtttcgcccctgaccatgaaggagctgcgtcagaagggtatgaccaagtatgatgct
gagatgatcatggccaatgcggcctaccagcaacagcagcaccaccaccaccaccatcat
catcagcactttcttcaccaccatcacaaccacggacagcatgccagcaccggggccgaa
gccacagccgccgtgcagcagctggcgatgcagaagccaggggtgttaccggttacatgc
actggagcagtagtaggagtagggcaaggtgcatgtgccgctggtggaactattacctcc
tccagcacggaattgaacggtcgctcaaactccctgcgaaagtccatccgagtaaacagc
accagcagcagcatatccacagcctccacggacgaggtggtggcagccaacgccccttca
atgcccctaccattgccattgacaatcccaatgtctgccaagtccgctgtggtgctggtg
acgcgatgcaagccggccatggccattgcggcgctgcaccagagacagcagagacaactg
cggcgcagcgagcggcaaacaaatcgaggtggacagaaggaaaagtcatttggaaaatat
atcacggacagcgagagcagcgacaccgaccatcagcggagtgagcgtcaagggatgaaa
gtgcgcggaggcgaggatcagcagcccacaaaagttttccttatggatggtgagcagcag
caggagaggcgcgtgacgcggaatagtgcgggaagagctgccgcagcagcagcagcagca
gcatcggcaccggcatcaggaggactaggacttctaggcctagggagattagccactgcc
cataatagtagtaatataacagcagcaacagccacaaccacatccacaagtagcatcagc
agcaacaaagcaaccacgattacaaattgtaataatcataatagtgttgatagcagtaga
attaatcataattctaatcttagcggtagacatagtgttaaatcaaagaagccaccacca
agtgaggcctcatctatacccacatccacgtcctcagttgatgcgcagtccttacaccag
tctcagcagcagaaggcaacgcgtcgcagcaacagtcccgcccataagaagaatcttttg
gacacctttaaccaggctcaacaggcttatcctccttctcatctattggcggaagaagat
ccccccaagcagaaacgtagtcgtcgagccgctgcattggctgcagcccagcacatccat
tgcgaggctttcggtggacaggttggattaggatttggactgggagtaggaacaagagca
ggaccaacagcaacaggcagcttgcgcaaaagacagcaaccagctagtgcaggagcagca
acaggggtagccagcgaaaaagcatccatcagactgtccaacagcagcagcagcattgag
ccccttctgaagactcccgagcgtcggctgaagctcactctgcggatgaagcgttctccg
attctggatgaagtcattgagctcggcaccagcttcagcgacgagcggcatctggcccgg
cacaatggagctatcggaggacgtagtgcaggcgtgactggagctagttttggatcgggt
ggagcggtgggcagtgccgatgtgacaggagcagaggggattgacattgagtatgagatc
ctacgcatggaaggcatctcggagcatggcaacgatgatgacgtcgacgacgacgacgac
gacgacgacgacgacgacgacgacgacgacgacgacgaggacgacgacaaggacgacaac
gacgacgacgacgatgacgacgacgacgacgacgatgacgatgacgacgacgacgaagaa
gaagaagatgaagatgaagacgacgacgacgacgacgacgaggacgataatgcagaagat
ctgcccgaacaggatgcagagcagccacaggtgccgctcgaagcggccccacccagtacc
atccactacgagccgctttcaaagaaacagaagaagaaacagcgaggctgcagtagccag
cggcggtccccggatcccagctcgagtaccagcagcatgtacgtgacaccccagaaaaag
cgactccgcttaatcttcggcaacgagtcccacaccattgacattccaccaacgggcgaa
ggagcatgcggagcagcggaaggtggagcagaagccaccggagtggatgatctgaacagt
agcagcggcggagtgagtgcaagcgacgactcgtttaatgcatcgtacgccagtagcggc
accagcatgacggtcaacgcctcctcccagatgacaaccagcaacaacagtagcggtgtc
gggccagttatccccatgtcctctggcacgggcaacgtgcaaacagagggcatagactcc
acggccaagctggtggcacccgcccaaacaccgcagtcgccgacatcttcgaccagcggc
tcgttttattctgcctgtacctccactaccaacacgccctacttccccaaaggagaacgg
cgtggaggagcaggaaccgggccaggcgaggaagcaacctacatcaattactatcagagt
agtggctcaaaggtacttggaaaatacagagccatgaagccgataacttcaagcccgggc
caggggcaggctattgtgagcagcagcagcggtagtggtgtaggggcaggacacggattt
ctgccacaatcgctgaccattcccaagcacaccttcggaacttgcgccctgctggccccc
accagctttgccagtctccagcagccgccaccgccttcggtgcagcatcatcaacaggcg
aagactagcgtggccacatcaacgtccgcctcctgctcgccgcctgtgcataaccaccat
catcatagccaacagcaccagaatccacatcataaccaccatatacagcaataa

DBGET integrated database retrieval system