KEGG   Drosophila persimilis: Dper_GL13412Help
Entry
Dper_GL13412      CDS       T01063                                 

Definition
GL13412 gene product from transcript GL13412-RA
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
dpe  Drosophila persimilis
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dper_GL13412
  Energy metabolism
   00920 Sulfur metabolism
    Dper_GL13412
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Dper_GL13412
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dper_GL13412
    3.1.3.25  inositol-phosphate phosphatase
     Dper_GL13412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 210 aa AA seqDB search
MCFTSSQSTSKMNGRSIRINRVPATIFAILLTIVLVYFLNFHQEERPAIYGKLRSDNPNR
VNLRKMLIAAIQASQRGGLEVLDVARSRQLKERSKGQTDEGVNDPFTDADGRSHCVMKQG
LQRIFPRVRIFSEEDKEHCKESHSYDLDPTVLHETAQVPDVSVNAQDVTVWVDPLDATKE
FTEELYEYVTTMVCVAVAGRPVIGGYPQPL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttcaccagcagccagagcaccagtaagatgaacggacgctccatacgtatcaat
cgggtgccagccaccattttcgccatcctgctgaccattgtgctggtctattttctgaac
ttccaccaggaggagcggccggccatctatggcaagctgcgcagcgacaatcccaaccgg
gtgaacctgcgcaagatgctgatcgccgccatccaggcttcgcagcgcggcggtctcgag
gtgctcgacgtggcccgctcccggcagctgaaagagcggagcaagggccaaacggacgaa
ggcgtaaacgatccgtttaccgatgccgacggtcgttcgcactgcgtcatgaagcagggc
ctgcagcgcatatttccacgtgtccgcatattctcagaggaggacaaggagcactgcaaa
gagtcgcacagctacgatctggatcccacggtcctgcatgagaccgcccaggtgccggac
gtgtctgtcaatgcccaggatgtcacagtctgggtggatcctttggatgctaccaaggag
tttactgaggagctgtacgagtatgtcaccaccatggtgtgcgtggccgtggccggtcgt
cccgtgattgggggttatccacagcccctttaa

DBGET integrated database retrieval system