KEGG   Drosophila persimilis: Dper_GL13561Help
Entry
Dper_GL13561      CDS       T01063                                 

Definition
GL13561 gene product from transcript GL13561-RA
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dper_GL13561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 331 aa AA seqDB search
MDREEIVWVRKEDARVPGKLPIVYSKSYAVRFHGLERLHPFNAAKGKHIHKALCAELSLV
EGSFYEPEELTKHQLRRIHTREYLRSLRWSLNVARIAEVSLMAFVPNKYLQQAYLRPMRF
QAAGSILAGKLALDYGWAINLGGGFHHCCSNRGGGFCPYADISLLIVRLFEQEPCRVRRI
MIVDLDAHQGNGHERDFNNWETVFILDIYNAFIYPRDHAAKLSIRCGVELQNQTEDAYYL
RQLSRCLMQSLADFRPDVVIYNAGTDVLKGDPLGNLDISAEGVLERDRLVFSTFRALGIP
VVMLLSGGYTKASAHVIADSIVNLRQHGLLD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggatcgagaggaaattgtatgggtcaggaaggaggacgcccgggtccccggcaagctg
ccaatcgtctattcaaagagctacgcagtgcgcttccatggccttgaacgcctgcacccc
ttcaacgcggccaagggcaagcacatacacaaggctctgtgcgccgaactttcgctggtc
gaaggcagcttctacgagcccgaggagctcaccaagcaccagctgcgtcgcattcacacc
cgcgagtacctgcgttcactccggtggagcctgaacgtggcccgcatcgccgaggtgtcg
ctgatggctttcgttcccaacaagtacctgcagcaggcctatctgcgtccgatgcgcttc
caggcggccggctccattctggccggaaaactggccctggactatggctgggccatcaac
ttgggtggcggcttccaccactgctgttcgaacaggggcggcggcttctgtccctacgca
gacatctccttgctgattgtccgtctctttgagcaggagccctgccgcgtccgccgcatc
atgattgtcgacctggacgcccaccagggaaacgggcacgagcgcgacttcaacaactgg
gagactgtcttcatactggacatatacaatgctttcatctaccccagagaccatgccgcc
aagctaagcatacgctgcggcgtggagctgcagaaccagaccgaggacgcctactacttg
cggcagctcagccgctgcctgatgcagtctctggccgacttccggcccgatgtggtcatc
tacaatgccggcaccgatgtcctcaagggggatcccctggggaacctggacatctccgcc
gagggggtcctggagcgcgaccgattggtgtttagcactttccgtgccctaggcatcccg
gtggtcatgcttctcagcggtggctatacgaaggcctccgcacacgtcattgccgattca
attgtcaatctccggcagcacggactactggactga

DBGET integrated database retrieval system