KEGG   Drosophila persimilis: Dper_GL13654Help
Entry
Dper_GL13654      CDS       T01063                                 

Definition
GL13654 gene product from transcript GL13654-RA
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dpe  Drosophila persimilis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dper_GL13654
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dper_GL13654
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dper_GL13654
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dper_GL13654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 560 aa AA seqDB search
MSASKGVLLLAVLLLIAAIGGRGETVPCKVKDAEQGKVCVCTADYCDYLENPTLTDDTEF
ALISSSKQGLRFATSHGHFGTEDTYTVQDYTVEPVPEAKNKTIFSRLLDQALDSAFTLES
RESTITRFVTLKVNRSKTYQTMTGFGGSYTGAVSYLVDNFKQPELADHLYKSFYAEEGLG
FNLMRISIGGCDFDLGAWAYAEEEDNTMLDGMDELDERDVMRVGHIKRLVEVSGIKNLRI
KGAAWSAPPWMKTNNRWTGFGRLKKQYYQTWADYHLKWVKLMEDNGLPIWAISTGNEPLN
GIFFMYFVKFMSMGWTPQTQAIWLNDHLGPTIRNSEFKDIILFGNDDQRYSFPHWFKMMN
YTRPNSVDYLDGLSLHWYWDEIFGSSLIDETTDYAPDKLLIVSESCIGDKPWQRSAPVLG
SWERAEKYTRAFLENIKHGFHAWIDWNIILDEEGGPNYVDNTVDAPVIANTTTNEEFYKQ
PMFYAMGHFSKLVPEGSIRVDAVPSNVNLDCVAFLRPDKKIAAVLFNSGRADTNITVVDS
ERGQFTVNVPAKSIHTLLYS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccagcaaaggagttttgctgctcgcagtgctgctgctgatagctgcaatcggt
ggccggggggaaacggtgccgtgcaaagtgaaggatgcggagcagggaaaggtgtgcgtg
tgcacggctgattattgcgactacttggagaatcccacgctgacggacgacacagaattt
gcactgatttccagctccaagcagggtctgcgattcgccacatcccacggacacttcggg
acagaggacacgtacactgtgcaggactatactgtggagcccgttccagaggccaaaaac
aagacaattttctcccgcttgctggatcaggctttggacagtgccttcaccttggagtcg
cgcgagagcaccatcacccgcttcgtgacactgaaagtgaatcgcagcaaaacctaccag
acaatgacgggcttcggtggtagctacaccggagccgtatcctacctagtcgacaatttc
aagcagcctgagctcgccgaccatctgtacaagtccttctacgctgaagaggggctgggc
ttcaatctgatgcgcatatcgatcggcggctgcgactttgacctcggtgcctgggcctat
gccgaggaagaggacaacacaatgctcgacggcatggacgagctggacgaacgcgatgtg
atgcgtgtgggccacataaaacgcctcgtcgaggtctcgggcataaagaatctgcgaatt
aagggtgcggcctggagtgctccgccttggatgaagacgaacaacaggtggacaggattc
ggacgtctcaagaagcagtactaccagacctgggccgactaccacctcaagtgggtgaaa
ctgatggaggataatggactgcccatctgggccatttccacaggcaacgagccactgaac
ggaatcttcttcatgtactttgtcaaattcatgagcatgggctggactccacagacgcag
gccatctggttgaacgaccatctggggccaacgatccgaaactctgagttcaaggatatc
atccttttcggcaacgatgatcagcgctactcctttccacactggttcaaaatgatgaat
tacacacgccccaattcggttgattacctggacggattatcgctgcactggtattgggat
gagattttcggtagcagtcttatcgatgagaccaccgattacgcgcccgacaagctccta
atcgtctccgagtcgtgcatcggcgataagccctggcagaggtcggcccccgtcctgggc
agctgggagcgggctgagaagtacacgcgcgccttcttggagaacataaaacatggcttc
catgcctggatcgattggaatatcattttggacgaggagggcggccccaactatgtggac
aatacagtcgatgcccccgtcattgccaacaccacaaccaatgaggagttctacaagcag
cccatgttctatgccatgggtcacttctccaagctggtgccagagggctccatacgcgtc
gatgctgtgcccagcaacgtcaatctggattgcgttgccttcttgcggccggacaaaaag
attgccgccgtgctcttcaacagcggacgcgccgatacaaacattactgtggtggacagt
gagcgcggccagtttacggtcaatgtgcccgccaagtccattcacaccttgctgtacagc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system