KEGG   Drosophila persimilis: Dper_GL13869Help
Entry
Dper_GL13869      CDS       T01063                                 

Definition
GL13869 gene product from transcript GL13869-RA
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dpe  Drosophila persimilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dpe00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 472 aa AA seqDB search
MKTAVLGGGLSGLSAGYYLLRRFGNPLTIYEASPRVGGWIRTEARRDRDFIFETGPRTIR
PVGIPGANTLEMMEELQLPLKPIPRSHVAARNRMLYAKGQLCMLPNSPRGLFGVKPPFTQ
PLYKALLHDLSTGRTLASNEDESIYSFAERRFGKEIADYAISPMICGICAGDAKQISVRF
LMEGLFEKEQKYGGVLKGILYARFKDNVDEKKPGLFAQDQPKLYAQALQEKWAMYSIEGG
LEVLPRAMRKYLDQHNVNVQLSNACQTLTFSKSGVRMSLRNADVPVDHVVSSLPAYKLAP
LLKPQHPSLCEQLLEIPYVNVVVVNIQYNGNQLKQDGFGLLVPPVEKLPILGVIFDSCCF
DMNGNTVLTVMMGGHWFDQWFGHQPSQKQILDIAKKYVREILDIQEEPKFSRVHILPKCI
PQYTVGHKERVKRIRKYLKDYKLPLSLCGAAFDGVGINDVILSARRQVDAIP
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggccgtgctgggcggcggcctgagtggcctctccgccggttattacctgttg
cggcgattcggcaatcctctgaccatctacgaagcctccccgcgagtcggtggctggata
cggacagaggcgcgcagggatcgcgactttatatttgagactggaccacgcactatacgt
cccgttggtatacctggagccaatacgctggagatgatggaggagctgcagttgcccctg
aagccaatccctcggagtcatgtggcggctcgcaatcgcatgctgtatgccaagggccag
ctgtgtatgctgcccaatagtcccagaggactgtttggcgtcaagccgccattcactcaa
cccctgtataaggcactgctccacgatctgtccacggggaggactttggccagcaacgag
gacgaatcgatatacagctttgccgagcgccgctttggcaaggagatagccgactacgcc
atcagccccatgatctgtggcatttgcgccggcgatgccaagcagatcagcgttcgcttc
ctaatggagggacttttcgagaaggagcagaaatacggcggcgtgctcaagggcatccta
tatgcccgcttcaaggataatgtagacgagaagaagccgggactgtttgcccaagatcag
cccaaactctatgcccaggccctgcaggagaagtgggcgatgtacagcatcgagggtgga
ttggaggtactgcctcgagccatgcgcaagtatctcgaccaacacaacgtcaacgtgcag
ctaagcaacgcgtgccagactttgacattcagcaaaagtggagtccgcatgtccctacgc
aatgctgatgtccctgtggaccatgtcgtgagctctctgccagcctacaaactggctcca
ctcttgaagccacagcacccctcgctgtgcgagcagctcctggaaattccctatgtgaat
gtagtggtcgtcaacattcagtataatggcaatcagctcaagcaggacggcttcggtctg
ctggtgcctcccgtcgaaaagctgcccattttgggtgttatctttgacagctgctgcttt
gacatgaacggaaacacggtgctaaccgtgatgatgggcggtcattggttcgaccaatgg
tttggccatcaacccagccagaagcagattctcgatattgccaaaaagtacgtgcgcgag
atactcgacatccaggaggagcccaagttcagtcgcgtccacattctccccaagtgcatt
ccacagtataccgtgggccacaaggaacgcgtgaagaggatccgcaagtatctgaaggac
tacaagctgcccttgtcgctgtgcggtgctgccttcgatggcgtaggcatcaacgatgtt
atattgtcggctcgtcgtcaggtggacgccataccgtag

DBGET integrated database retrieval system