KEGG   Drosophila persimilis: Dper_GL13883Help
Entry
Dper_GL13883      CDS       T01063                                 

Definition
GL13883 gene product from transcript GL13883-RA
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
dpe  Drosophila persimilis
Pathway
Fanconi anemia pathway
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:dpe03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 815 aa AA seqDB search
MQENDLNERQEEPASLPPTSNDTNNKNTSCNDSSELQISSESVTVTDQQQPQVAIEEPQI
AEQVDSSTTANPDTGDTTRPERLSPTLPLVALYPAIFEVADKVVDQAVDEPSSVVGPDRD
ELLPLTPKRKRQRRVYIADTSRCLRSRQESKDTTEAGSKQVPTTPTPPPTQVASPTPTES
TEYIKPEQFNPAFWNLIEEEEFKFVGKKRRVAGGRNRTRRGRLLNELGENYAPETAAAIA
AAQLELDSSGKPSSRAKRKRNTTMSLYDRRFQSTADERRVPNGYGGNGLRTGSAATSSDI
EPQELQVHPYYGSSGGSNPTGAGAGLNGSGAALNHAPSMGTLCNIGNTCYLNSVVYTLRF
APLFLHNLHHLIHDLNVVQQIIVRQKTAKSASLGRNVSATQLEHARSWSSKDLATSEQYN
SSTNGSSSGGVSGSSTSTSSIKETYQSVTEKLHELYNSLHGNEMADSTEPYHADTLLHAI
QVVNSTFEGNQQQDAHEFLMCVLNCIRETNQALIKAVDECPEVIANGYIANPDEVDSAEA
AQERTDTAGPLASSGNGNTSQITTTKTSFFSRKSKRKDEVKSSKSTRIQSPLKDNSPTAG
GLTAAPAHSTANSLFYLNTVDLSGASSVAAPAATPTVSQPASTGKYSSDDEMNPASALKN
NMRLEDRIRDLHLNFFSADFEGTVVLTTKCLSCETVTKQKQGMLDISVPVPISGYDNADL
QDKPSTYIQNSCITKEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGME
KVSTYVPTAFTLPCFCAKCCELSDGNKLHVYSCTV
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaatgacttaaacgagcgtcaagaggaaccagccagtcttccacctacaagc
aacgacacaaacaacaaaaacacaagctgcaacgacagcagcgaactccaaatttccagt
gagtcggtcacggtcacggatcagcagcaaccacaggtggctatcgaggaaccgcaaata
gccgagcaggttgattcttccacgacagctaatccagacacaggtgatacaaccaggccg
gaaaggctttcccccacattaccgctcgtagccctatatcctgctatattcgaagttgcc
gataaagtcgtcgatcaagcggtagatgagccgtcgtctgtagtgggtccagatagggac
gagctattgccgctaactcccaaacgaaagcgtcagcgtcgtgtttatatcgcggacaca
tcccgctgcctgcgatcgagacaagagtcgaaagacacaaccgaggcggggtcgaagcag
gtgccgacaacaccaacgccaccgccaacacaggtcgcctcaccgacgcccacagaatcc
acagagtacatcaaaccagagcaatttaatccggcgttctggaatttgattgaagaagag
gaatttaaattcgtcggcaagaagcgacgcgttgccggtggacgtaatcgcacgcgacgc
ggcaggctactgaacgagctcggtgaaaactacgccccggaaacagcggccgctattgcg
gcggcacaacttgagctcgattcgtcagggaagccatcatcacgtgccaaacgtaagagg
aacaccaccatgtcgttgtacgaccgtcgattccagagcaccgccgatgagcggcgcgtg
ccgaacgggtatggcggcaacggattacggacaggcagtgcggccacttcgagtgacatt
gagccgcaggagttgcaggtccatccgtattatggatcttcggggggcagcaatccaacg
ggcgccggggcgggcctaaatggcagtggagccgctctcaaccatgctccttcaatgggc
accctctgcaacattggcaacacatgctacttgaactcggtagtgtacacgctacgcttt
gctccactctttctgcacaacctgcaccatctgatccacgacttgaacgtggtgcagcag
attatagtgcgccagaagaccgccaagtcggcctcgctggggcggaacgtgagtgccacg
cagctggagcatgcacgcagctggagcagcaaggatctggccacctcagagcagtacaac
agcagcaccaatggcagcagcagtggcggggtcagtggcagcagcaccagcaccagctcg
atcaaggaaacctatcagtcggtcacggagaagctgcacgagctgtacaacagcctgcat
ggcaacgaaatggccgactcgacggagccctaccatgcggacacactgctgcatgccata
caggttgtgaattccacatttgagggcaaccagcagcaggacgcccacgagtttctcatg
tgcgttctcaactgtattcgcgaaacgaaccaagctctgatcaaggccgtggacgaatgc
cccgaggtcattgcaaacggttatatagccaatcccgatgaggtggactctgcggaggct
gcccaggagcgtacggataccgcggggcctctggcaagctctggcaatggcaacactagt
caaataaccacgacaaaaacatctttcttctcacgcaaatcaaagagaaaagatgaggtc
aagtcatcgaaatcgacgcgtatacagtcaccgctgaaggacaacagtccgacggcgggt
ggtctcaccgcggcaccggcgcattccactgcaaacagtctcttctatttgaatacagtt
gatctcagcggcgccagcagcgttgcggccccggcagcaacaccgaccgtttcgcagcca
gcgtcgaccggaaaatactcgagcgacgatgaaatgaacccggccagtgcgctgaagaac
aacatgcgattggaggaccgcatacgggatctgcatctgaacttcttcagtgccgacttt
gagggcactgtggtgctgaccaccaaatgtctcagctgtgagacggtcacgaagcaaaag
cagggcatgctcgacatctccgtgcctgtgccgatatcaggctacgacaatgccgacctc
caggacaagcccagcacctacattcagaattcttgcatcacaaaggagtactttcggggt
gagaacaaatacagttgcaatcagtgcaccggctacaccgaggccatacggtccatctcg
tacgaagtgctgcctcgattgctggtcattcagctgaatcgtttctcgggcggcatggag
aaggtgagcacgtatgtgcccacggcctttacactcccgtgcttctgcgccaagtgctgc
gagctgagcgacggcaacaagctgcacgtgtacagctgtacagtgtga

DBGET integrated database retrieval system