KEGG   Drosophila persimilis: Dper_GL13992Help
Entry
Dper_GL13992      CDS       T01063                                 

Definition
(RefSeq) GL13992 gene product from transcript GL13992-RA
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
dpe  Drosophila persimilis
Pathway
dpe04140  Autophagy - animal
dpe04213  Longevity regulating pathway - multiple species
dpe04310  Wnt signaling pathway
dpe04341  Hedgehog signaling pathway - fly
Module
dpe_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dper_GL13992
   04341 Hedgehog signaling pathway - fly
    Dper_GL13992
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dper_GL13992
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dper_GL13992
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dper_GL13992
Protein kinases [BR:dpe01001]
 Serine/threonine kinases: AGC group
  PKA family
   Dper_GL13992
Messenger RNA biogenesis [BR:dpe03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dper_GL13992
Chromosome and associated proteins [BR:dpe03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dper_GL13992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 6595310
NCBI-ProteinID: XP_002020437
FlyBase: FBgn0151597
UniProt: B4GNC3
AA seq 374 aa AA seqDB search
MSQQQFQFNNKEDYNTILDAMSKDFNERWNKQTKSPYTNLENYVQRAVLGNGSFGTVLLV
REKGGKNYYAAKMMSKEDLVRLKQVNHVHNEKTVLSATRFPFLIHLIDSSKDFDYLYLIL
PFVNGGELFSYHRKMRKFSEKQSRFYASQVVLALEYMHYMNLMYRDLKPENILLDVNGYI
KLTDFGFTKVPVPVPVLARTIFLPLNRSVFSAWRDAPPTLCGTPEYLAPEIIQLKPYNKS
VDWWAFGILLFEFVSGRSPFASHNRDVILMYSKICLGEFRIPNYFSAHLKTLVEALMQVD
TSKRLGNSPDGPADIKTHPWFQGVDWFAVLNQQVTPPYIPTVTNIEDLSHFDHFESKAKL
KSRINRHPELFMDF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcagcagtttcagttcaacaacaaggaagactacaacaccatcctcgacgcg
atgagcaaggacttcaatgagcgctggaacaagcagacgaagtccccctacaccaatctg
gagaactacgtgcagcgagcggtcctcgggaatggcagcttcggcactgtgctccttgtc
agagagaaggggggcaagaactactatgccgccaagatgatgagcaaggaggatctggtg
cggctgaagcaggtcaatcatgttcacaacgagaagacggtcttgagcgccacccgattc
cccttcctcatccacctgattgactcctccaaggactttgactacctctatctcatcctg
cccttcgtcaacggcggcgagctcttctcctaccaccgcaaaatgcggaagttcagcgag
aagcagtcccgattctatgcctcccaggtggtgctggccctcgagtacatgcactacatg
aatctcatgtaccgcgacctgaagcccgagaatatcctcctggacgtgaacggatacatc
aagctcacggactttggcttcacgaaggtaccagtaccagtgccagtactagctaggact
atatttctacctctcaatcgatctgtttttagcgcgtggagggacgcaccacccaccctg
tgcggcactcccgagtacctggccccggagatcattcagctgaagccgtacaacaagtcc
gtggactggtgggccttcggcatcctgctctttgagttcgtgtccggccgctcgccgttc
gcctcccacaaccgggacgtcattctgatgtactcgaagatctgcctcggggagttccgc
attcccaattactttagcgcccacctgaagacacttgtggaggcactcatgcaggtggac
acgtccaagcgcctaggcaactccccggacgggcccgcggacatcaagacccacccgtgg
ttccagggcgtcgactggttcgcggtgctgaaccagcaggttacgccgccctatattccg
accgttaccaacatcgaggacctctcgcacttcgaccacttcgagagcaaggccaagctc
aagtctaggatcaatcggcatccggagttgtttatggatttctag

DBGET integrated database retrieval system