KEGG   Drosophila persimilis: Dper_GL13992Help
Entry
Dper_GL13992      CDS       T01063                                 

Definition
GL13992 gene product from transcript GL13992-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dpe  Drosophila persimilis
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dper_GL13992
   04340 Hedgehog signaling pathway
    Dper_GL13992
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dper_GL13992
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dper_GL13992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 374 aa AA seqDB search
MSQQQFQFNNKEDYNTILDAMSKDFNERWNKQTKSPYTNLENYVQRAVLGNGSFGTVLLV
REKGGKNYYAAKMMSKEDLVRLKQVNHVHNEKTVLSATRFPFLIHLIDSSKDFDYLYLIL
PFVNGGELFSYHRKMRKFSEKQSRFYASQVVLALEYMHYMNLMYRDLKPENILLDVNGYI
KLTDFGFTKVPVPVPVLARTIFLPLNRSVFSAWRDAPPTLCGTPEYLAPEIIQLKPYNKS
VDWWAFGILLFEFVSGRSPFASHNRDVILMYSKICLGEFRIPNYFSAHLKTLVEALMQVD
TSKRLGNSPDGPADIKTHPWFQGVDWFAVLNQQVTPPYIPTVTNIEDLSHFDHFESKAKL
KSRINRHPELFMDF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcagcagtttcagttcaacaacaaggaagactacaacaccatcctcgacgcg
atgagcaaggacttcaatgagcgctggaacaagcagacgaagtccccctacaccaatctg
gagaactacgtgcagcgagcggtcctcgggaatggcagcttcggcactgtgctccttgtc
agagagaaggggggcaagaactactatgccgccaagatgatgagcaaggaggatctggtg
cggctgaagcaggtcaatcatgttcacaacgagaagacggtcttgagcgccacccgattc
cccttcctcatccacctgattgactcctccaaggactttgactacctctatctcatcctg
cccttcgtcaacggcggcgagctcttctcctaccaccgcaaaatgcggaagttcagcgag
aagcagtcccgattctatgcctcccaggtggtgctggccctcgagtacatgcactacatg
aatctcatgtaccgcgacctgaagcccgagaatatcctcctggacgtgaacggatacatc
aagctcacggactttggcttcacgaaggtaccagtaccagtgccagtactagctaggact
atatttctacctctcaatcgatctgtttttagcgcgtggagggacgcaccacccaccctg
tgcggcactcccgagtacctggccccggagatcattcagctgaagccgtacaacaagtcc
gtggactggtgggccttcggcatcctgctctttgagttcgtgtccggccgctcgccgttc
gcctcccacaaccgggacgtcattctgatgtactcgaagatctgcctcggggagttccgc
attcccaattactttagcgcccacctgaagacacttgtggaggcactcatgcaggtggac
acgtccaagcgcctaggcaactccccggacgggcccgcggacatcaagacccacccgtgg
ttccagggcgtcgactggttcgcggtgctgaaccagcaggttacgccgccctatattccg
accgttaccaacatcgaggacctctcgcacttcgaccacttcgagagcaaggccaagctc
aagtctaggatcaatcggcatccggagttgtttatggatttctag

DBGET integrated database retrieval system