KEGG   Drosophila persimilis: Dper_GL13992Help
Entry
Dper_GL13992      CDS       T01063                                 

Definition
GL13992 gene product from transcript GL13992-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dpe  Drosophila persimilis
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dpe04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:dpe04340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 374 aa AA seqDB search
MSQQQFQFNNKEDYNTILDAMSKDFNERWNKQTKSPYTNLENYVQRAVLGNGSFGTVLLV
REKGGKNYYAAKMMSKEDLVRLKQVNHVHNEKTVLSATRFPFLIHLIDSSKDFDYLYLIL
PFVNGGELFSYHRKMRKFSEKQSRFYASQVVLALEYMHYMNLMYRDLKPENILLDVNGYI
KLTDFGFTKVPVPVPVLARTIFLPLNRSVFSAWRDAPPTLCGTPEYLAPEIIQLKPYNKS
VDWWAFGILLFEFVSGRSPFASHNRDVILMYSKICLGEFRIPNYFSAHLKTLVEALMQVD
TSKRLGNSPDGPADIKTHPWFQGVDWFAVLNQQVTPPYIPTVTNIEDLSHFDHFESKAKL
KSRINRHPELFMDF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcagcagtttcagttcaacaacaaggaagactacaacaccatcctcgacgcg
atgagcaaggacttcaatgagcgctggaacaagcagacgaagtccccctacaccaatctg
gagaactacgtgcagcgagcggtcctcgggaatggcagcttcggcactgtgctccttgtc
agagagaaggggggcaagaactactatgccgccaagatgatgagcaaggaggatctggtg
cggctgaagcaggtcaatcatgttcacaacgagaagacggtcttgagcgccacccgattc
cccttcctcatccacctgattgactcctccaaggactttgactacctctatctcatcctg
cccttcgtcaacggcggcgagctcttctcctaccaccgcaaaatgcggaagttcagcgag
aagcagtcccgattctatgcctcccaggtggtgctggccctcgagtacatgcactacatg
aatctcatgtaccgcgacctgaagcccgagaatatcctcctggacgtgaacggatacatc
aagctcacggactttggcttcacgaaggtaccagtaccagtgccagtactagctaggact
atatttctacctctcaatcgatctgtttttagcgcgtggagggacgcaccacccaccctg
tgcggcactcccgagtacctggccccggagatcattcagctgaagccgtacaacaagtcc
gtggactggtgggccttcggcatcctgctctttgagttcgtgtccggccgctcgccgttc
gcctcccacaaccgggacgtcattctgatgtactcgaagatctgcctcggggagttccgc
attcccaattactttagcgcccacctgaagacacttgtggaggcactcatgcaggtggac
acgtccaagcgcctaggcaactccccggacgggcccgcggacatcaagacccacccgtgg
ttccagggcgtcgactggttcgcggtgctgaaccagcaggttacgccgccctatattccg
accgttaccaacatcgaggacctctcgcacttcgaccacttcgagagcaaggccaagctc
aagtctaggatcaatcggcatccggagttgtttatggatttctag

DBGET integrated database retrieval system