KEGG   Drosophila persimilis: Dper_GL14069Help
Entry
Dper_GL14069      CDS       T01063                                 

Definition
(RefSeq) GL14069 gene product from transcript GL14069-RA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dpe  Drosophila persimilis
Pathway
dpe00010  Glycolysis / Gluconeogenesis
dpe00051  Fructose and mannose metabolism
dpe00562  Inositol phosphate metabolism
dpe01100  Metabolic pathways
dpe01200  Carbon metabolism
dpe01230  Biosynthesis of amino acids
Module
dpe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dpe_M00002  Glycolysis, core module involving three-carbon compounds
dpe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dper_GL14069
   00051 Fructose and mannose metabolism
    Dper_GL14069
   00562 Inositol phosphate metabolism
    Dper_GL14069
Enzymes [BR:dpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dper_GL14069
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dper_GL14069
  Exosomal proteins of bladder cancer cells
   Dper_GL14069
  Exosomal proteins of melanoma cells
   Dper_GL14069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 6595048
NCBI-ProteinID: XP_002020571
FlyBase: FBgn0151674
UniProt: B4GNQ7
AA seq 299 aa AA seqDB search
MDNNPSADISVDLRLSVSSKAHKPTAVFPKLSKRPSEGQKKLYANFSTDSKMSARKFCVG
GNWKMNGDQKSIAEICKTLSGAALDPNTEVVIGCPAIYLMYARNLLPCTVGVAGQNAYKV
AKGAFTGEISPSMLKDIGADWVILGHSERRAIFNESDELIAEKAEHALAEGLKVIACIGE
TLDEREAGKTNEVVARQMCAYAKKVRDWTNVVVAYEPVWAIGTGKTATPEQAQEVHAFLR
QWLTDNISKEVSAALRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFVDIINARQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggacaacaacccgagcgctgacatatcggtggacttgcgcctgagcgtttcatcgaaa
gctcacaagccaacagctgttttcccaaagctttcaaagcgcccgtcggaaggtcagaag
aagctctacgcaaacttcagcacagacagcaaaatgagcgcccgaaaattctgcgtggga
ggcaactggaagatgaacggcgaccagaagtccattgcggagatctgcaagactcttagc
ggtgccgctttggaccctaacactgaggtggtcatcggctgcccggctatctacctgatg
tacgcccgcaacctgctaccctgtaccgtgggcgtggcgggccaaaacgcatacaaggtg
gccaaaggagccttcacgggggagatctctccatccatgctcaaggatatcggggcggac
tgggtcatcctgggccactctgagcgtcgcgccatcttcaacgagtccgacgagctgatc
gccgaaaaagcagagcatgctctggccgaaggtctaaaggtaatcgcctgcatcggtgag
acactggatgagcgcgaggctggtaagaccaacgaagtcgtcgcccgtcagatgtgcgcc
tatgccaagaaggtgcgcgactggaccaacgtggttgtcgcctacgagcctgtgtgggcc
atcggcactggcaagactgccacccccgaacaggctcaggaggtgcacgccttcctgcgc
cagtggctgaccgacaacatatccaaggaggtttccgccgcgttgcgcatccagtacggt
ggctctgtgaccgcagccaacgccaaggagctggcgaagaagccagacatcgacggcttc
ctagtcggcggtgcttccctgaagcccgaatttgttgacatcatcaacgccagacaataa

DBGET integrated database retrieval system