KEGG   Drosophila persimilis: Dper_GL14247Help
Entry
Dper_GL14247      CDS       T01063                                 

Definition
GL14247 gene product from transcript GL14247-RA
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dpe  Drosophila persimilis
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dper_GL14247
   04150 mTOR signaling pathway
    Dper_GL14247
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Dper_GL14247
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dper_GL14247
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   Dper_GL14247
Mitochondrial biogenesis [BR:dpe03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Dper_GL14247
  Mitophagy factors
   Other mitophagy factors
    Dper_GL14247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 581 aa AA seqDB search
MPQTRAAAAEAAAAGTVNGQPLVKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILN
RQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKH
GKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGE
FLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKS
GIFPIPEYLNKQVVNLVDPLKRANIEEIKKHEWFQKELPAYLFPSSIEQDSNVIDTYAVA
EVCTKFGVKELEVHNSLLSGDPHDQLAIAYHLIIDNKRFADDAANQINEINNFFVAGSPP
PPPIATHASHETPGQASGQTPLATVTVGGGTAASSGSATPVPPGVAPPSSSVLAAIRPHP
ERIAPMRDRQLAMSVQNSGGAAFPEKTARGGTPIKRAKWHLGIRSQSKPNDIMLEVYRAM
KALNYEWKIINPYHVRVRRQNVKTGKFSKMSLQLYQVDAKSYLLDFKSLTNEEVEQGDDV
IMESLTPPPLSVTGLMPLQPTGHHTMEFFEMCAALIIQLAR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgccccagacgagggctgcggccgctgaggcagcggcggcgggcaccgtcaatggccag
ccgctagtgaaaatcgggcattatctgttgggcgccacgctcggtacgggcacctttggt
aaggtaaagatcggtgagcatcagattacgcgcgtcaaggtcgccgtcaagattcttaac
aggcagaagatcaagagcctagatgtggtgggtaagattcggcgagagatccagaatctg
aagctcttccggcatccgcacatcattaagctttatcaggtgatctccaccccatcggac
atcttcatgatcatggagtacgtgagcggcggcgaactgttcgactacatcgtgaaacac
ggcaagctgcaggagcatcaggcgcgccgcttcttccagcagatcatctcgggcgtggat
tactgtcaccggcacatgattgtgcaccgcgacctgaagccggagaacctcctgctcgac
cacaacatgcacgtgaagatcgctgactttgggctatcgaacatgatgctggacggagag
ttcctgcgcacctcgtgcggctctcccaactatgcggcgcccgaggtcatttcgggcaag
ttgtatgccggtcccgaggtggacatctggtcgtgcggcgtcattctgtacgccctgctc
tgcggcacgctgcccttcgacgacgagcacgtgccgacgctcttccgaaagatcaaatcg
ggcatcttccccataccggagtacctcaacaagcaggtggtcaatctggtggatcccctc
aagcgggctaacatcgaggagatcaagaagcacgagtggttccaaaaggagctgcccgcc
tacctcttcccctcgtcgattgagcaagactcgaatgtcattgacacctatgccgtggcc
gaggtctgcaccaagttcggggtcaaggagctcgaggtgcacaactcgctgctcagcggc
gatccacacgaccagctggccatcgcgtaccacctgatcatcgacaacaagcgcttcgct
gacgacgccgccaaccagatcaacgagatcaataacttctttgtggccgggtccccgccg
ccgccgccaatcgccacccatgcatcgcacgagaccccaggacaagcctccggccagacg
cctctggccacggtaactgtgggcggcggaacggccgccagttcgggcagcgccacgcct
gtgccacccggagtggcgccgccgagcagcagcgttctggccgccatacgaccgcatccg
gagagaatcgcaccgatgcgcgaccgccagctggccatgtccgtgcagaactcgggcggc
gctgccttccccgagaagacggcgcgcggcggtacacccatcaagcgggccaagtggcat
ttgggcatacgatcgcagagcaagcccaacgacataatgctggaggtgtaccgggccatg
aaggcgctcaactacgagtggaagatcatcaatccgtatcatgtccgtgtgaggcggcag
aacgtgaagacgggcaagttctcgaagatgtcgctgcagctgtaccaagtggacgccaag
agctatctgctcgacttcaagtccctcaccaatgaagaggtggagcaaggggacgacgtc
atcatggagagcctcacaccgccaccgcttagcgtgaccgggttgatgccgctccagccg
accggccaccataccatggaattcttcgagatgtgcgcggcgctcattatacagctggcg
cgctga

DBGET integrated database retrieval system