KEGG   Drosophila persimilis: Dper_GL14297Help
Entry
Dper_GL14297      CDS       T01063                                 

Definition
GL14297 gene product from transcript GL14297-RA
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dpe  Drosophila persimilis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dper_GL14297
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dper_GL14297
   04070 Phosphatidylinositol signaling system
    Dper_GL14297
 Organismal Systems
  Sensory system
   04745 Phototransduction - fly
    Dper_GL14297
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Dper_GL14297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 924 aa AA seqDB search
MTKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGR
DGDVIELCQVSDIRAGGTPRDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHV
ICPDAATAKSWQKNLRIITHNNRATNVCPRTNLMKHWMRLSYCVEKSGKIPVKTLAKTFA
SGKTEKLVYTCIKDAGLPDDKNATMTMDQFTFDKFYALYHKVCPRNDIEELFTSITKGKQ
DFISLEQFIQFMNEKQRDPRMNEILFPLYEEKRCTEIVNDYELDEEKKKSVQLSLDGFKR
YLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGC
RCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNR
AQQYKLAKYCDDFFGELLLKEPLADHPLDPGLPLPPPCKLKKKILIKNKRMKPDVEKVEL
ELWLKGELKTDDDPEEDASAGKPPEAAAAPAPVPEAAAAADGAAEGGGGAEAEAAAANYS
GSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYN
KRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQTSDLPMQLNQGKFEYNGGCGYLL
KPDFMRRADKDFDPFADAPVDGVIAAMCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVK
KEFRTRLVPNNGLNPVYNEDPFVFRKVVLPDLAVLRFGVYEESGKMIGQRILPLDGLQPG
YRHVSLRTEANFPMSLPMLFVNIELKIYGPDGFEDFMAMLDLKELNAKQAKTSADTAKEV
QNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGRAMEKLKLAHSKQVEEFSTDV
QKLMDMYKIEEEAYKTQGKTEFYA
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaagtacgagttcgattggatcatcccggtgccgccggaattgaccactggc
tgtgtcttcgaccgttggttcgagaacgagaaggagaccaaggagaatgactttgagcga
gatgccctcttcaaggtcgatgaatatgggttctttttgtactggaagagcgagggtcgg
gatggcgatgtcatcgagctgtgccaagtgagcgacattcgtgcgggcggcactcccagg
gatcccaagatactggataaggtgaccaaaaagaatggaaccaacataccggagctggac
aagcgatctctcactatttgctcgaacacggattatatcaatataacatatcaccatgtt
atctgccccgatgcggcaacggccaagagttggcaaaagaatttgcgtatcataacgcat
aacaatcgcgccacaaatgtgtgtccgcgcaccaatctgatgaagcattggatgagacta
agttattgcgtggagaagagcggcaagataccggttaagacgctggccaagaccttcgcc
tcgggcaagaccgagaagctggtctacacgtgcatcaaggatgcgggtctgccagacgac
aaaaatgccaccatgaccatggatcagttcactttcgataagttctatgccctctaccac
aaggtctgtccccgtaacgacatcgaggagctcttcacgtcgattaccaagggtaaacag
gactttatcagtctcgagcagtttatacagttcatgaacgagaagcagagggatccgcgc
atgaacgagatcctctttccgctctacgaggagaagcgctgcacggagatcgtaaacgac
tatgagctggacgaagagaagaagaaaagcgttcaactatccctggacggattcaagcgc
tatctgatgtccgatgagaacgcacccgtgtttctggatcgcctggacttctacatggag
atggaccagccactggcccactactacatcaatagctcgcataacacctacttgtccggc
cgacagatcggcggaaagagctccgtggagatgtaccgccagacgctgcttgccggctgt
cggtgtgtggagctcgactgctggaacggcaagggggaggacgaggaaccgattgtcacc
cacggtcacgcctactgcacggaaatcctcttcaaggactgcatccaggccatcgcggac
tgtgcgttcgtctcgtccgagtatccggtgatcctgtccttcgagaaccattgcaaccgg
gcccagcaatacaagctggccaaatactgtgatgacttcttcggggagctgctcctgaaa
gaaccgctcgcagatcatccgctggatccgggcctgcccctgccgccgccgtgcaagctg
aagaaaaagatactcatcaagaacaagcgcatgaagcccgacgtggagaaggttgagctg
gagctctggctgaagggcgagctgaagaccgatgacgatcccgaggaggacgccagtgcc
gggaagccgccggaggctgcggccgctcccgcaccagttcccgaagccgcagccgctgcc
gacggtgctgccgaaggaggtggcggtgccgaggcggaggcagcggcggccaactacagt
ggctccaccaccaatgtacatccctggctttcatcgatggtcaattacgcgcagcccatt
aagttccagggcttcgataaggcaattgagaagaacattgcccacaacatgtcctcgttt
gcggaatcggcgggcatgaactacctgaagcagagctccattgatttcgtcaattacaac
aagcgccagatgtcgcgcatctacccgaagggcaccagggcggactcctcgaactacatg
ccgcaggtgttctggaacgccggctgccagatggtgtcgctgaatttccagacctccgat
ctgcccatgcagctgaaccagggcaagttcgagtacaatggcggatgcggatacctgctg
aagccggattttatgcggcgcgcggacaaggatttcgatccattcgccgacgcacccgtg
gacggtgtgatcgctgccatgtgctcggtgaaggtaatcgccggacagttcttgtcggac
aagaaggtgggcacctacgtggaggtggacatgtttggcctgccctcggacaccgtgaag
aaggagttccgcacccgtctggtgcccaacaacggattgaatccggtctacaacgaggac
ccgttcgtgttccgcaaggtggtcctgccggatctggccgtgctgcggttcggcgtctat
gaggagagcggcaagatgatcggtcagcgaatcctcccgctggacggactccagccggga
taccgccatgtgtcgctgcgcacagaggccaacttcccgatgtcgcttcccatgctgttt
gtgaacatcgaattgaagatttacgggcctgatggctttgaggacttcatggccatgctg
gatctgaaggaactgaatgccaagcaggccaagacctcagcggataccgccaaggaggta
cagaacgacaagactctcaagaccaagaacgagaaggatcgtcggctgcgcgagaagcgt
cagaacaatgtcaagcgattcatggaggagaagaagcaaatcggcgtgaagcagggacgc
gccatggagaagttgaagctggcgcattcgaaacaggtcgaggaatttagtaccgatgtg
caaaagctaatggatatgtacaaaatcgaggaggaggcctataagacgcaaggaaaaacg
gaattttatgcctaa

DBGET integrated database retrieval system