KEGG   Drosophila persimilis: Dper_GL14477Help
Entry
Dper_GL14477      CDS       T01063                                 

Definition
(RefSeq) GL14477 gene product from transcript GL14477-RA
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dpe  Drosophila persimilis
Pathway
dpe00040  Pentose and glucuronate interconversions
dpe00053  Ascorbate and aldarate metabolism
dpe00830  Retinol metabolism
dpe00860  Porphyrin and chlorophyll metabolism
dpe00980  Metabolism of xenobiotics by cytochrome P450
dpe00982  Drug metabolism - cytochrome P450
dpe00983  Drug metabolism - other enzymes
dpe01100  Metabolic pathways
Module
dpe_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dper_GL14477
   00053 Ascorbate and aldarate metabolism
    Dper_GL14477
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dper_GL14477
   00860 Porphyrin and chlorophyll metabolism
    Dper_GL14477
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dper_GL14477
   00982 Drug metabolism - cytochrome P450
    Dper_GL14477
   00983 Drug metabolism - other enzymes
    Dper_GL14477
Enzymes [BR:dpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dper_GL14477
Glycosyltransferases [BR:dpe01003]
 Others
  Hydrophobic molecule
   Dper_GL14477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 6595368
NCBI-ProteinID: XP_002020804
FlyBase: FBgn0152082
UniProt: B4GQC5
AA seq 532 aa AA seqDB search
MAVCLANKEMQTKVIVLSLICLCSGQAAKILVLFPHASESHFAVMRTLVTELASREHNVT
VYTGHGLGERLENVSETIIPEYPFWSNLQKHAAPKGNLADLGRLSIPTLRKSLAVVGANA
LDHFLSQEPLQKLLQQPPLDFDFDVIILDYFYTEALLALGQFHQKPIVGIVSTDFGNYME
AVQESMVPAACSPIDFEHYVPSLGFSARLGNIRECISRRKQFAKDHFGAQEQLIAKHFKV
KSSVPELQANQLSLLLVNSHVPLMTPRPSLQHIVPAGGLHIRGPRELPWNIKRFLEEARA
GAIYLQLGNEQPCGELPKLKLEALLGFFDSRKERFIWSCHDVKTLDGLPKNVMIQHAVPQ
IDILAHPRVNAFIMNGDLLSLQEAIVRNVPTLGLPIFQNERQNMELAVRLGVGLKLEQEN
VTIASLSWAVDRLLLEPQYQITIRDVSLEFRDRPLGALASAMFWVNYVARHKGGAAIRTR
GVGISSNQLHLFDLFLFYFGVALFFVGLLVGLCLVAIFFWQKKISTKNTKLN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccgtctgtttggccaacaaggaaatgcaaactaaggtgatcgtgctctccctgatc
tgtctatgctccggccaagcagccaagattcttgtgctcttcccacatgccagcgagagt
cattttgcggtgatgcgcactctggtcacggagctggccagccgggaacacaatgttacg
gtatacactggacacggtctgggagagcgcttggagaacgtgtcggagacgattattccc
gaatatccattctggagcaacttgcaaaagcatgcagcacccaaaggtaatctggccgat
ctgggaagattgtcaattccaactcttcgcaagtccctggctgtcgtcggagccaacgcc
ttggaccacttcctcagccaagagcccctgcagaagctgctgcagcagcccccattggac
ttcgacttcgacgtgataattttggactatttttacacggaggctctactggctctgggc
caattccaccagaagcctatcgttggcatcgtgagcacggactttggcaactacatggag
gcagtacaggagtccatggtgccagcggcatgctcccccattgactttgagcattatgtt
ccttcgctgggattctcggcgagattgggaaacatccgggagtgcatctcgcgcaggaag
cagttcgcaaaggatcatttcggggcacaggaacagctcatcgctaagcactttaaagtg
aaatcgtctgtgccagagctgcaggcgaatcagctttctctgctcttggtcaacagccac
gtgcccctgatgacgcctcgtccgagtctgcagcacattgtgcccgccggtggccttcac
attcgtggtccgcgggagctgccatggaatattaagaggtttctggaggaagcccgtgcc
ggagccatatacttgcagctgggaaacgaacagccatgcggcgagctgcccaagttgaag
ttggaagcgctcttagggttctttgactcccgcaaggaaaggttcatttggtcctgccac
gacgtgaagactttggacggtctgcccaagaacgtgatgatccaacatgcggtgccgcag
atcgacatcttggcccatccccgggtcaacgccttcattatgaacggagatctgctcagt
ctgcaggaggcaatcgtcagaaatgtgccaactctggggctgccgattttccagaacgag
cggcagaacatggagctggcagtgagactaggtgttggcctgaagctggagcaagagaat
gtcacgattgcgtccctgtcctgggcggtagacaggctactgctggagccgcagtatcaa
attacgattcgggatgtatcgctcgagtttcgggacagacctctgggcgccctggccagc
gctatgttctgggtgaactatgtggccagacacaaggggggggctgcgatcagaacccga
ggtgttggcatctcttcgaatcagttgcaccttttcgacctgtttttgttctactttgga
gtggcgttattttttgttggcctgctggtgggtctgtgccttgtggccatatttttttgg
caaaaaaaaatttctaccaagaacaccaaattaaattag

DBGET integrated database retrieval system