KEGG   Drosophila persimilis: Dper_GL14559Help
Entry
Dper_GL14559      CDS       T01063                                 

Definition
GL14559 gene product from transcript GL14559-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 868 aa AA seqDB search
MYRLEDTNSGGVMDKNKQKLSAYGSSAGTVAVDASQGGGNGGGGGGRQRHAPLYGRFVVE
EDLPATHRDVMHHHPSPSSSSEVRAMQARIPAHFRDPASGPLRKLSVYYAKKKRRAQQTQ
GDDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQ
CHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNHLCLVFELLS
YNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSA
IKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFS
GCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVTDGSYVLKKNQNGRKYKPPGSRK
LHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKRT
ADESTNTSGAGATANAGAGGSGGGGCSGGGGGPGASTSSSAVSASSAPAAAAAAAASSSS
TTSSTTTTGGGGGGNGSGGSTGSGLAVAASQQPMSLPLPLPLAGPGGASSSTSVVDAHSH
GLHALMHSNAAASAMNNFSALSLQPATHPSALAAHNSHHSSNSSSIHSNSNNSSHSNSNS
SHSNSLNSLNHINSNSNSGGGNSRRHMYGSNNSYSHPMDCDPPHGQVMPPPPPNGRMRVP
ALLPMPNNYAPTSLPYYGNIASAAGGPAGPASMGATAATAVPVPVSAFMPLPLQPLPLPL
QLPLSTSSSSTGGMSSMPMPMPMPMPMPMSMQSAGQRRHVVGSVGAGVGVGVGAPGNSSG
SAAGASSDASSSSPMVGVCVQKNPVVIH
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgtatagattagaggatacgaatagcggcggcgttatggataagaataaacagaaatta
tctgcttatgggtccagtgcgggcaccgttgccgtggacgcatcgcagggtggtggtaac
ggtggtggcggcggcggcagacagcgtcatgcaccgctctatggacgctttgtggtcgaa
gaagatctgcctgccacgcatcgtgatgtgatgcatcatcaccctagtccttcgtcttcg
tcggaggtgcgtgccatgcaggcccgcattcccgcacactttcgcgatcccgcttcagga
ccattacgaaagctgagcgtatactatgcgaaaaagaagcgacgagcccaacaaacacag
ggcgacgatgattcgtccaacaaaaaggagcgcaaattatataacgatggctatgacgat
gataatcatgattatataatcaagaatggtgaaaagttcttggatcgctatgagattgat
tcgctaatcggcaagggcagtttcggtcaagtggtaaaggcctacgatcacgaggagcaa
tgtcatgtggcgatcaaaataattaagaataagaaaccgttcctaaatcaggcacaaatc
gaggtcaagctgctcgagatgatgaatcgtgcggatgctgaaaataaatattatatcgtc
aagctcaagcgtcactttatgtggcgcaaccatctgtgcctggtcttcgagctgctctca
tacaacctgtacgatctgcttaggaacacaaatttccgcggcgtctcgctgaacctcacg
cgtaaatttgcgcagcaactgtgcacggcgctgctgttcctcagcacgcccgaactgaac
ataatacactgtgatttgaagcccgagaatatcttgctatgcaacccgaagcgctcggcc
ataaagattgttgactttggcagctcctgccagttgggacagcgcatctatcactacatc
cagtcgcgtttctaccgatcgccagaggtgctactgggcatacagtacgatctggccatc
gatatgtggtcgctgggctgcattttggttgagatgcacacgggcgagccgctcttctct
ggctgcaatgaggtcgatcagatgaacaagattgtcgaggttctgggcatgccgcccaag
tatctgctcgatcaggcgcacaagacgcgcaagttctttgacaaaatcgtcaccgatggc
tcctatgttttaaagaagaaccagaatggacgcaaatacaagcccccgggatcgcgaaag
ctgcatgacatactcggcgtggagacgggtgggccgggtggtaggcgattggatgagccc
ggtcattcggtgtcggattatctcaagttcaaggatctgatattgcgcatgctggacttt
gacccaaagacgcgcgtcacaccgtactatgccttgcaacacaacttcttcaagcgcacc
gccgacgagtcgaccaacacaagtggcgccggtgccacagcgaatgccggggccggtggc
agcggcggcggtggctgcagtggtggtggcggcggaccgggtgcgagcaccagcagcagt
gccgtctctgccagttcagcgcccgcagcggcagccgcggcagcggccagttcatcctcc
accacctcctcaacgacaacaaccggcggcggcggtggtggcaacggcagcggcggcagc
actggctctggattggcggtggcggcgtcgcagcagccgatgtccctgccactgccactg
ccactggcgggtccgggcggtgcatcgtcgtcaacgtctgtggtggatgcccatagccat
ggtctgcatgcactaatgcactcaaatgccgcggccagcgccatgaacaacttctctgcc
ctcagtctgcagcccgccacccatccgtctgcgctggctgcccacaacagccaccacagc
agcaacagcagcagcattcacagtaacagcaacaacagcagtcacagtaacagcaacagc
agccacagtaacagtctgaatagcctaaaccacattaacagcaacagtaacagtggcggg
ggtaacagtcgccgccacatgtacggcagcaacaacagctattcgcatccgatggactgc
gatccgccgcacggccaggtgatgccgcccccaccgcccaacggtcgcatgcgtgtgccg
gccctgctcccgatgccgaacaactatgcgccaacatccttgccctactacgggaacatt
gcgtcggcagctggcgggccagccgggccggcatcgatgggagctaccgccgccactgcg
gtacctgtgcccgtgtccgcctttatgccactgccgctgcagccactgccactgccattg
caactgccgttgtcaacgtcctcctcctccacgggcggcatgtcctccatgcccatgccg
atgcccatgcccatgccaatgcccatgtccatgcaatccgcaggccagcgacgacatgtc
gttgggtctgttggtgcgggtgtgggtgtgggtgttggtgcacccgggaacagcagcggc
tcggcggcaggtgccagcagcgatgcctcttcctcatcgccaatggtgggcgtatgtgtt
caaaagaatcctgtagttatacattag

DBGET integrated database retrieval system