KEGG   Drosophila persimilis: Dper_GL14954Help
Entry
Dper_GL14954      CDS       T01063                                 

Definition
GL14954 gene product from transcript GL14954-RA
Orthology
K07204  
regulatory associated protein of mTOR
Organism
dpe  Drosophila persimilis
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dper_GL14954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1648 aa AA seqDB search
MERAVLADADTQAAAACSSLQRADIERRLSTKTPYRVIANYDETPPQYAGCHPTRIWSVI
RHGSRNPSKKVIMRAQQRLVELQQRLLSQPHPNLCPAEMKQLREWSWGHLNAAEDEKLLV
AEGEDELIELAERMQLRFPSLLPDMYDPAWYYMKYTDTQRTLKSAQSFATGLFGRHRIHA
VRYPRPVYRDPVLRTKASPAQSDSPLHTTTPPHHTTQQQHHSSSRHHATPHTVNNSNNSN
TSNNSSSNGSAVDIGSLMIGQDGPSNPSHKTITSASNRPPNEREWEREWEREWEREWERD
RGDREGDRSQYAGGPSLLVQLFHFDVVPSSFHFGHSEHDDSGISFSFSAKRHLELIEGLK
YERQAWRIRERMKTASVALVLCLNIGVDPPDVVKIQPCSRLECWIDPSSVSPPKAMELIG
SNLQMQYERWQPRARYKKCHDPTVDDVKKLCTSLRRNAKGERILFHYNGHGVPKPTANGE
IWVFNKTFTQYIPLSIFELITWMSAPSIYVYDCSNAGIIINSFQPYAEQHEHELEKALAI
AQQRGLAHLQPGSIPGSGSGGSSVQLPTQLVSYKNCIHLAACAANEILPMNAQLPADLFT
SCLTTPINIALKWYAMQEKLGMVPHIQSELIDKIPGKVNDRRTMMGELNWIFTAITDTIA
WNTLPRELFQRLFRQDLLVASLFRNFLLAERILRSHDCTPVSLPALPPCYRHPMWKAWDL
VVDLALQQLPEILDHSAPYRQLPFFEHQLTAFQVWLDSESESRTPPEQLPIVLQVLLSQV
HRLRALELLARFLDLGPWAVNLALGVGIFPYVLKLLQSSTRELRPVLVFIWAKILAVDPS
CQVDLVKEYKYFLSVLQDSTVSKEHRSLSAFVLASIVHNFLLGQTSALQGPLLSICLEQL
NDHSWLLRQWLAICLGMLWQNFEKARWSGARDLAHEKLYVLLRDSIPEVRAAAVFALGTF
ISSVTDRSEQQANNIDRIIAITLLETVGEDMSPLVRLELAAALQWMVLLFESQFVAVYLA
ENMRSSHAASTLVMLHGGSALPTGAHALASSTHSLERHMTMRRGVSSSSISNMGTGSGCG
SASLGSHSCRSSGRRRRAQSSRAKAAGERSGSVGGVAAGAGVAGGTNSIPFQSIFTKLWL
GICQLAQDPFPQVAATALKIVHHVRETARFPIMAAKEATMATASEKCNSLSVSLPPSPNT
RVTYLGGAVGSGQSPPVGCTTGVNAGASGGATTVGASHWAQKLRLSGSATGGGAAGAAGD
PQMILQRKLRTSSINDETDSGPAYVRGGAGGVAAGGLGPALGGEAAGGGSHSARSSGSES
NHYHEPGKGHGSHGQALQPIVKTEFIPWAISYFTRPGKHRYSSAEGKAEGEQRYPVDRNS
QELRTRRYRYQRNELIRRQARRPFYKLCDRWRTDVDKNPETFINARRFTEEPEMQSAVEH
VRGSTQLPDLGPEDVELMYMVCAFETSWQRRRQRESVWCSFFDVDALRALEFAKDLEYYW
NDGYGYELTHRIACPAIADMFSAIDPVSQAMPRANATFYFTHSGTLLKLLAHLGLAKDKE
ALTHKHFGSERLWRTSEIDAFATNLAFLRYECEQEPPRVLVLHQERAVRLPGCPQDEDLC
PLATIRRLYADSVERCDFEALCQVDDTK
NT seq 4947 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcagtattggccgatgccgatactcaggcggcggctgcctgcagcagcctg
caacgggccgacattgagcggcgcttgtccaccaagacaccctatagggttatagctaat
tacgatgagacgccgccgcagtacgcgggctgccaccctactcgaatctggtcggtcatt
cgccatggcagccggaatcccagcaaaaaggtcataatgcgcgcccagcagcgtctcgtg
gagttgcagcagcgcctgctcagccagccacatcctaatctctgcccagccgaaatgaag
caactccgtgaatggagctgggggcatctgaacgccgccgaggatgagaagctgctggtg
gctgagggcgaggatgagctgatagagctggccgaacgcatgcagttgcgctttccctcg
ctcttgccggacatgtacgacccagcctggtattacatgaagtacacggacacccagagg
acgctgaagagcgcccagagttttgcaacgggtctgtttggccgtcatcgcatacacgcg
gtgcgttatccccgacctgtgtatcgggatcctgtgcttaggaccaaggcctccccagca
cagtccgacagccccctgcacaccaccacacccccacaccacaccacacaacaacagcac
cacagcagctctcgacaccacgccacaccacacacagtcaacaatagcaacaatagcaac
accagcaacaacagcagcagcaatggaagcgctgtcgacattggcagcctaatgattggc
caggatggcccgtccaatcccagtcacaagacaatcacctcggcctcgaacaggccgccg
aatgagcgcgaatgggaacgggagtgggagcgggaatgggaacgcgaatgggaacgggat
cgtggcgatcgcgagggcgaccgcagccagtacgccggtggcccgtcgctgctcgtccag
ctctttcactttgatgtggtgcccagcagcttccatttcgggcatagcgagcacgacgac
tcgggcatctcgttctcgttctccgccaagcggcatctggagcttatcgagggactgaag
tacgagcgtcaggcatggcgcatccgggagcgcatgaagacggccagcgtggcgctggtg
ctctgcctgaacattggtgtggatccgccggatgtggtgaagatacaaccctgctcccgc
ctcgaatgctggattgatcccagctctgtgtcgccgccgaaggccatggagctgatcggt
agcaatctacagatgcagtacgaacggtggcagccccgtgcccgctacaagaagtgtcac
gatcccaccgtcgatgatgtgaagaagctctgcacctcgctgcgtcgcaacgccaagggg
gagcgcatcctcttccactacaatgggcatggggtgcccaagccgacggccaatggagag
atttgggtgttcaacaagaccttcacgcagtacatacccctgagcatctttgagctgatc
acatggatgtcggcgccgtcgatctatgtgtacgattgctccaatgcggggatcatcatc
aactccttccagccgtatgctgagcagcatgagcacgagctggagaaggccctggccatt
gcccagcagcggggcctggcccatctgcagcccggctctataccgggctctggatccggc
ggctcctctgtacagctgccgacgcagctggtcagctacaagaactgcatacatttggcc
gcgtgtgcggccaacgagatactgccgatgaatgcccagctgccggcagatctcttcacc
agttgcctgaccacgcccattaacattgccctcaagtggtatgcgatgcaggagaagctg
gggatggtgccgcacatccaaagcgaattgattgacaagataccaggcaaagtcaacgac
agacggaccatgatgggagaactcaactggatttttacggccatcacggatacgatagcc
tggaatacgctcccacgggagctgttccagcgtctgttccgccaggatctgctggtggcc
agcctctttcggaattttctgcttgctgagcgcatcctaaggagccacgattgcacgccc
gtatcgctgccggcactgccgccctgctaccgccatccgatgtggaaggcctgggatctg
gtggtggacctggcactgcagcagctcccagagatactggaccatagcgccccgtaccgg
cagctgccgttcttcgagcatcaattgacggcctttcaggtgtggctggacagcgaatcg
gagtcgcgcacaccgcccgaacagctgccgattgtgctgcaggtgctgctgtcgcaggtg
catcgcttgcgggcgttggagctgctggcccgcttcctggacctcgggccctgggccgtc
aatctggccctgggcgtgggcatctttccgtatgtcctcaagctgctgcagagctcaacg
cgcgagctgcggccagtgctggtgtttatttgggccaagatattggccgtggatcccagc
tgccaggtggatctggtcaaggagtacaagtactttctgtccgtgctgcaggacagcacc
gtctccaaggagcaccgcagcctctccgccttcgtgctggcctccatcgtgcacaacttc
ctgctcggacagacgagcgccctgcagggacccctgctctccatatgcctggagcagctt
aacgatcacagctggctcctgcgccagtggctggccatctgcttgggcatgctatggcag
aactttgagaaggcccgctggtcgggggcccgtgatctggcccacgagaagctctatgtg
ctgctccgcgactcgatccccgaagtgcgtgcggccgccgtcttcgccttgggcaccttc
atcagctccgtgacggaccgcagcgagcagcaggcgaacaacattgaccgcatcatagcc
atcactctgctggagactgtcggggaggatatgtcgccgctggtgcgcctggaactggcc
gccgccctccagtggatggtgctgctcttcgagtcgcagtttgtggccgtatatctggcg
gagaatatgcgcagcagccatgccgcctccaccctcgtgatgctccatggcggcagtgcc
ctgccgacgggtgcccacgcgctcgcctcgtccacccacagcctggagcggcatatgacg
atgcgtcgtggcgttagctccagttccatatccaatatgggcacgggctctggctgcggt
tcggccagtctagggtctcacagctgcaggagcagcggcaggaggaggagggcccagtcg
agccgggcaaaagcagcgggcgaacgctcgggctccgtgggaggagtggcagcgggcgca
ggcgtggccggaggcaccaacagcataccgttccaatcgatcttcaccaaactgtggctg
ggcatctgccaacttgcccaggatccgttcccccaggtggctgccaccgccctaaagatt
gtccatcacgtgcgcgaaaccgcccgctttccgatcatggccgccaaggaggccacgatg
gccacggcctccgagaagtgcaacagcttgagcgtcagtctgcctcccagccccaacacg
cgagtcacctatctcgggggcgccgtggggagcggccaatcgccgcccgtgggctgcacc
accggcgtgaatgcgggcgccagtggcggcgccaccacagtgggtgccagccattgggcc
cagaagctgcggctgtcagggagtgccacaggaggcggagccgccggtgcagcgggggat
ccacaaatgatattgcagcgcaagctgcggacgagctcgatcaacgatgagactgacagc
ggaccagcctatgtccgcggcggcgccggaggagtagcggccggcggcctgggacccgca
cttggaggagaggcggctggcggtggcagccactcggctcgcagcagcggcagcgagagc
aatcactaccacgagccgggcaagggccacggcagccatggacaggcgctgcagcccata
gtcaagacagagttcataccgtgggccatttcctactttacgcggccgggcaagcatcgc
tacagctcggcggagggtaaagcggagggagagcagcgctaccccgtggatcgcaattcg
caggagctgcgcactcgacggtatcgctaccagcgcaacgaactgatccgccgacaggcg
cgacgcccattctataaactctgcgacagatggagaactgacgtcgataagaatcccgaa
acttttattaatgcacgccggttcaccgaagagccggagatgcagtcagcagtggagcat
gtgcggggcagcacccagctgccggacttgggccccgaggatgtggagcttatgtatatg
gtgtgcgccttcgagacatcctggcagcgtcgacggcagcgcgaatcggtctggtgcagc
ttcttcgatgtggatgccttgagggccttggagtttgccaaggatctggagtactattgg
aacgatggctatggctatgagctgacccatcgcattgcctgtccggcgatagcagatatg
ttttcggccatcgacccagtctcccaggccatgccccgggccaatgccacgttctacttc
acccattcgggtacactgctgaagctgctggcccatctcggcctggccaaggacaaggag
gcactcacacacaagcattttggcagcgagcgtctctggcgcaccagcgaaatcgatgcc
tttgcgaccaacttggcttttctgcgctacgaatgcgagcaggagccgcctcgtgtcctg
gtgctgcaccaggagcgtgcagtccgcctgccaggttgcccacaagacgaggacctgtgc
ccgctggccacgatccgccgcctatatgcggacagtgtggagcgctgcgactttgaggcc
ctctgccaagtcgacgacaccaaatga

DBGET integrated database retrieval system