KEGG   Drosophila persimilis: Dper_GL15016Help
Entry
Dper_GL15016      CDS       T01063                                 

Definition
GL15016 gene product from transcript GL15016-RA
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dpe  Drosophila persimilis
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dper_GL15016
   03008 Ribosome biogenesis in eukaryotes
    Dper_GL15016
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Dper_GL15016
Ribosome biogenesis [BR:dpe03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Dper_GL15016
Transfer RNA biogenesis [BR:dpe03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Dper_GL15016
Mitochondrial biogenesis [BR:dpe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Dper_GL15016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 192 aa AA seqDB search
MESNAPELGAKPRTNNRNSHSRRNQSDSANHRVVRKLPPRADNDRCNIYITSKTDFKAQQ
RRCEELLNSGVKEIFLHCMGYSITRGLNLALRLIKNSEGALGYTINTSTIHWWDELHPLC
DEDDITFRQRNNSALHIKIFSNSLFNIDVPQLPAQPALPKVSQREPPKPHQQQQQQQPQK
AKAKKQTTRSQK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaatgcgcctgagctcggggccaagccaagaaccaacaatagaaacagccac
tcaaggcgaaaccagagcgacagtgccaatcacagagtggttcgcaagctaccgcctcgt
gctgacaacgaccgctgcaacatctacattaccagcaaaacagacttcaaggcacagcag
aggcgatgcgaggaactgctcaattcgggcgttaaggagatattcttgcattgcatggga
tactcgatcactcgcggccttaacttagccctgcgtcttatcaagaactcggagggtgcc
ttgggctacactatcaacacctccaccatacattggtgggacgaactgcatccgctctgt
gatgaggacgatataacctttcggcagcgaaacaactctgctctgcacatcaagatcttc
agcaacagtctttttaatattgatgtgccccagcttccagctcagcctgctctaccaaag
gtcagccaacgcgagccgccaaagccccaccagcagcagcaacagcagcaaccacagaag
gctaaggccaagaagcagacgaccaggtcgcaaaagtaa

DBGET integrated database retrieval system