KEGG   Drosophila persimilis: Dper_GL15026Help
Entry
Dper_GL15026      CDS       T01063                                 

Definition
GL15026 gene product from transcript GL15026-RA
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
dpe  Drosophila persimilis
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dper_GL15026
Enzymes [BR:dpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     Dper_GL15026
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     Dper_GL15026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 433 aa AA seqDB search
MYPYQTLSIGPAVEGYKLGKVLIEGKTKQVYDLPEHPGLCLLLSKDRITAGDGVKAHDLA
GKAEISNTTNGQVFRLLNEAGIRTAYVKHCGAKAFIARKCEMIPIEWVTRRLATGSFLKR
NVGVPEGYRFSPPKQETFFKDDANHDPQWSEEQIISAKFELNGLPIGQDEVDIMRRTTLL
VFEILERAWQTKNCALIDMKVEFGIDADGNIVLADIIDSDSWRLWPSGDKRLMVDKQVYR
NLTSVTSSDLDTVKRNFIWVSEQLADIVPRKDHLVVVLMGSASDTSHSEKIATSCRSLGL
NVELRVSSAHKGPEETLRIVREYESVMNNLIFVAVAGRSNGLGPVVSGSTNYPVINCPPV
KSDNMQVDVWSSLNLPSGLGCATVLYPEAAALHAATILGLGNFMIWSRLRVKGLNNFITL
KKADKELRGVRSA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtatccctatcaaacgctatccatcggtcccgcagttgagggctacaagcttggcaag
gttctaatcgaggggaagaccaagcaggtgtacgacctgcccgagcatcccggactgtgc
ctgctgctgagcaaggatcgcatcactgccggcgatggtgtcaaggcgcatgatttggcc
ggcaaggcggagatctcgaacaccaccaacggccaggtctttcgcctgctcaacgaggct
ggtatacgcactgcctatgtgaagcattgcggggcgaaggcctttattgcccgcaaatgc
gagatgatacccatcgagtgggtaactcgacgcctggccactggatcgttcctcaagcgc
aatgtcggcgtgccggagggctacagattctcaccacccaaacaggagaccttcttcaag
gatgacgccaaccacgatccccagtggagcgaggagcagataatctcggccaaattcgag
ctcaatggcttgccaattggccaggacgaggtggacattatgcgccggacgactctgctg
gttttcgagatactggagcgggcctggcagacaaagaactgtgcgctgatcgacatgaag
gtggaattcggcatcgatgccgatggcaacattgtgctggccgacattatagactcagat
tcgtggcgcctctggccgtcgggcgacaagcgcctgatggtcgacaagcaggtgtaccgc
aacctcacatcggtcacgtccagtgacctcgacacggttaagcgcaactttatctgggtg
tcggagcagctggcggatattgtgccgcgcaaggaccacctggtggtggtgctcatgggc
agcgcctcggacacctcgcacagcgagaagatcgccaccagctgccgctctctgggcctc
aacgtggagctgcgcgtcagctcagcccacaagggaccggaagagacgcttcgcatcgtc
cgcgagtacgagtcggtgatgaacaaccttatctttgtggccgtagccggacgttccaat
ggactgggcccggtggtatcgggcagcaccaactatccggtgatcaactgcccgcccgtc
aagtccgacaacatgcaggtcgatgtctggtccagcctgaatctgccctcgggcctcggc
tgtgccaccgttctttatccggaggcggcggccctacatgccgccaccattctgggcctg
ggcaacttcatgatctggtctagactgcgggtcaagggcctcaataacttcatcaccctg
aagaaggccgacaaggagctgcgcggcgttcgcagtgcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system