KEGG   Drosophila persimilis: Dper_GL15026Help
Entry
Dper_GL15026      CDS       T01063                                 

Definition
GL15026 gene product from transcript GL15026-RA
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
dpe  Drosophila persimilis
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dpe00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 433 aa AA seqDB search
MYPYQTLSIGPAVEGYKLGKVLIEGKTKQVYDLPEHPGLCLLLSKDRITAGDGVKAHDLA
GKAEISNTTNGQVFRLLNEAGIRTAYVKHCGAKAFIARKCEMIPIEWVTRRLATGSFLKR
NVGVPEGYRFSPPKQETFFKDDANHDPQWSEEQIISAKFELNGLPIGQDEVDIMRRTTLL
VFEILERAWQTKNCALIDMKVEFGIDADGNIVLADIIDSDSWRLWPSGDKRLMVDKQVYR
NLTSVTSSDLDTVKRNFIWVSEQLADIVPRKDHLVVVLMGSASDTSHSEKIATSCRSLGL
NVELRVSSAHKGPEETLRIVREYESVMNNLIFVAVAGRSNGLGPVVSGSTNYPVINCPPV
KSDNMQVDVWSSLNLPSGLGCATVLYPEAAALHAATILGLGNFMIWSRLRVKGLNNFITL
KKADKELRGVRSA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtatccctatcaaacgctatccatcggtcccgcagttgagggctacaagcttggcaag
gttctaatcgaggggaagaccaagcaggtgtacgacctgcccgagcatcccggactgtgc
ctgctgctgagcaaggatcgcatcactgccggcgatggtgtcaaggcgcatgatttggcc
ggcaaggcggagatctcgaacaccaccaacggccaggtctttcgcctgctcaacgaggct
ggtatacgcactgcctatgtgaagcattgcggggcgaaggcctttattgcccgcaaatgc
gagatgatacccatcgagtgggtaactcgacgcctggccactggatcgttcctcaagcgc
aatgtcggcgtgccggagggctacagattctcaccacccaaacaggagaccttcttcaag
gatgacgccaaccacgatccccagtggagcgaggagcagataatctcggccaaattcgag
ctcaatggcttgccaattggccaggacgaggtggacattatgcgccggacgactctgctg
gttttcgagatactggagcgggcctggcagacaaagaactgtgcgctgatcgacatgaag
gtggaattcggcatcgatgccgatggcaacattgtgctggccgacattatagactcagat
tcgtggcgcctctggccgtcgggcgacaagcgcctgatggtcgacaagcaggtgtaccgc
aacctcacatcggtcacgtccagtgacctcgacacggttaagcgcaactttatctgggtg
tcggagcagctggcggatattgtgccgcgcaaggaccacctggtggtggtgctcatgggc
agcgcctcggacacctcgcacagcgagaagatcgccaccagctgccgctctctgggcctc
aacgtggagctgcgcgtcagctcagcccacaagggaccggaagagacgcttcgcatcgtc
cgcgagtacgagtcggtgatgaacaaccttatctttgtggccgtagccggacgttccaat
ggactgggcccggtggtatcgggcagcaccaactatccggtgatcaactgcccgcccgtc
aagtccgacaacatgcaggtcgatgtctggtccagcctgaatctgccctcgggcctcggc
tgtgccaccgttctttatccggaggcggcggccctacatgccgccaccattctgggcctg
ggcaacttcatgatctggtctagactgcgggtcaagggcctcaataacttcatcaccctg
aagaaggccgacaaggagctgcgcggcgttcgcagtgcctaa

DBGET integrated database retrieval system