KEGG   Drosophila persimilis: Dper_GL15046Help
Entry
Dper_GL15046      CDS       T01063                                 

Definition
GL15046 gene product from transcript GL15046-RA
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dpe  Drosophila persimilis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dper_GL15046
Enzymes [BR:dpe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dper_GL15046
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C44
   Dper_GL15046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 563 aa AA seqDB search
MCGIFAIFSRDSKPVGTQVLHGSKHSLREMAYRQSGKQRHRGPDSTGVHVIAEDGVAMVH
ERLRIVGVERGDQPFVSNDGNVVLVANGEIYNYLELSAEIAKRLGTYKPKSDCHVILELY
EVYGEDLLSHITGMFAFALYDKRTKQVLLARDPFGIIPMYIGEDKAGNMWVASEMKCLVD
TCSKVETFTPGEARFGRVGEMRTFRHFQQSWIKELPTNPCDLNLLRSSLESAVRTHLHCD
VNFGALLSGGVDSSLIAAIATKIMREKDPYYRLKTFSVGLADAPDFKAARHVAKYIGSDH
KEIVFQIDEALDGIRDIVYHLETYDVTTVRCSLPMLLLTRYIKSTGIKMILSGEGADEIF
GGYLYFHKAPNCEQFHQELVKRVQQLHLSDCLRANKVAMAKGVELRVPFLDTGFVNHVMQ
IRPQDKIPGELNAFAEALGPLRRIEKYVLRAAFTENYLPDDVLWRQKEQFSDGVGYDWID
SIRRVATSHVGDEEFAEATRRFPFNTPTTKEAFYYRCIFEEQFPVEGAARTVVRWVPRLD
WGCPEDPSGRAQAVHQVNKDVII
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatttttgcaatattttcaagggattcgaagcctgttggcacgcaggttctg
cacggcagcaagcatagtctgcgcgagatggcctaccgccagagtggaaagcagcggcat
cgtggccccgactctactggcgtccatgtcatcgcagaggatggtgtggccatggtccac
gaacgtctgcgcattgtgggtgtggagcggggtgaccagccgtttgtgtccaacgatggg
aacgtggtgctggtggccaacggagagatctacaactacctggagctgtcggcggagata
gcaaagcggcttggaacctacaagccgaagagtgactgtcacgtcatcctggagttgtac
gaggtctatggggaggatctactgagccacatcaccggaatgttcgccttcgccctgtac
gacaaacgcacgaagcaagtgctccttgccagggatccctttggcatcattcccatgtac
atcggcgaggataaggccggtaacatgtgggtggcctccgaaatgaagtgcttggtggac
acttgtagcaaagtggagacgtttacgccgggcgaagctcgcttcggacgcgtgggagag
atgcgaaccttccggcactttcagcaatcctggatcaaggaacttcctaccaacccttgc
gacctgaacctactccgttccagcctggagtcggcggtgcgcacacatctccactgcgac
gtcaactttggggctctgctgtcggggggcgtggactccagcctgattgccgcgatcgcc
acgaagatcatgcgggagaaggacccttactatcgcctgaagaccttctctgtgggtctg
gccgatgcgcccgattttaaggcggcccgccacgtggccaagtacatcggcagtgaccac
aaggagatcgtctttcaaattgatgaggccctagacgggatccgcgatattgtctatcac
ctggagacctatgacgtcaccactgtgcgctgcagcctgccaatgctgctgctgacccgc
tacatcaagagtaccggcatcaagatgatcctctccggcgagggggcggacgagatcttc
ggcggatacctgtacttccacaaggcccccaactgcgagcagttccaccaggagctggta
aagcgcgtacagcagctacatctctccgactgcctgcgcgccaacaaggtggcgatggcc
aagggcgtggagctgcgcgtacccttcctggacacgggcttcgtcaatcatgtgatgcag
atccggccccaggacaagattcctggcgagctcaacgcgtttgccgaagccctaggaccc
ttgaggcgcattgagaagtacgtgttgcgggctgccttcaccgaaaactatttgccggac
gacgtgctttggcgccagaaggagcagttttccgacggcgtcggctacgactggattgat
agcatccgccgtgtggccaccagtcacgtgggagacgaggagttcgccgaggctacccgc
agattccccttcaacacgcccaccacaaaagaggcattctactatcgatgcatcttcgag
gagcagttcccggtcgagggagcggcccgcacggtggtcaggtgggtgccacgcctggat
tggggctgtccggaggacccctcgggacgggcacaggccgtccatcaagtcaataaagac
gttataatttaa

DBGET integrated database retrieval system