KEGG   Drosophila persimilis: Dper_GL15140Help
Entry
Dper_GL15140      CDS       T01063                                 

Definition
GL15140 gene product from transcript GL15140-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dpe  Drosophila persimilis
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dper_GL15140
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Dper_GL15140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 635 aa AA seqDB search
MPLHLNSQQGVCHPRQEPHQQKNKLQQVQSPPMELVMLLLLMLTLLTRPLSAFSNRLSDT
KLHEIYLDEKEIKLSWMVDWYKQEVLFHLQNAFNEQHRWFYLGFSKRGGLADADICFFEN
QNGFFNAVTDTYTSPDGRWVRKDYQQDCEVFKMDEFTLAFKRKFDTCDPLDLRLHEGTMY
VVWARGESELSLEDHQFALPNVTSAHEAGVKMLQILRADKILIPEKDLDMVEITLSKAPI
PSEETTYWCHVQRLDDFVKHRHHIVQFEPLIKNPGIVHHMEVFHCEGGEHEEMPLYNGDC
TNLPAKAKVCSKVMALWAMGASTFTYPPEAGLPIGGPGYNPYVRLEVHFNNPEKQAGLID
NSGFRIKMSRTLRQFDAAVMELGLEYTDKMAIPPGQTAFPLSGYCVADCTKAALPATGII
IFGSQLHTHLRGVRVLTRHFRGDQELREVNRDDYYSNHFQEMRTLHYKPRVLPGDALVTT
CYYNTLNDTRTALGGFSISDEMCVNYIHYYPATKLEVCKSSVSEETLENYFIYMKRTEQQ
RGIHLNGARSANYRSIEWSQPRVDQLYTMYIQEPLSMQCNTSDGGRFASQSWEGVAPTAV
QIKIPIHRKLCPNYNPLWLRPLEKGECDLLGECIY
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgcatctgaatagtcaacaaggcgtttgccatcctcggcaggagccgcatcaa
caaaagaataaactgcagcaggtacagtcgccgccaatggagctagtgatgctgctcctc
ctgatgctgacgctcctaacgcggcccctgagcgccttctcgaaccgcctgtcggacacg
aagctgcacgagatctatctggacgagaaggagatcaagctcagctggatggtggactgg
tacaagcaggaggtgctctttcacctgcaaaatgccttcaacgagcagcaccgctggttc
tacctgggcttctcgaagcggggcggcctcgccgatgcggacatttgcttcttcgagaat
cagaacggcttcttcaatgcggtgaccgacacttacaccagtccggacgggcgctgggtg
cgcaaggactaccagcaggactgtgaggtcttcaagatggacgagttcacgctggccttc
aagcggaagttcgacacttgcgatcccctcgatctgcggctccacgagggcaccatgtat
gtggtgtgggcgcggggcgaatccgagctttcgctggaggatcaccagttcgcgctgccc
aatgtgacgtctgcccacgaggcgggcgtaaagatgctgcaaattctccgtgctgacaag
atactcattcccgaaaaagatctggatatggtggagatcaccctttcgaaggcccccatc
cccagcgaggagaccacctactggtgccacgtacagcgtctggacgacttcgtcaaacat
cgccaccacattgttcagttcgagccgctgatcaagaacccgggcattgtacaccacatg
gaggtgttccactgcgagggcggggagcacgaggagatgcctctgtacaacggcgactgc
acaaatttgccggccaaggccaaggtctgctcgaaggtgatggccctctgggccatgggc
gccagcacattcacctatccgccagaggccggcctgcccattggcggccccggttacaat
ccctatgtccggctcgaggttcacttcaataatcccgagaaacaggctggcctcattgac
aactccggctttcgcatcaagatgtcgaggaccttgcgacagttcgacgcagccgtcatg
gagctgggcctagagtatacggacaagatggccataccgcccggtcaaacggccttccca
ttgagcggctactgcgtggcggactgcacgaaggctgcactgccggcgaccggcatcatc
atctttggatcgcagttgcacacgcacctgcgcggcgtgcgggtacttacgcgccacttc
cgcggggaccaagagctgcgagaggtgaaccgagacgactactactcgaatcacttccag
gagatgcgcacgctgcactacaagcctcgtgtactgcccggggatgctctggtgaccact
tgctactacaacaccctaaacgacacgaggactgccctggggggcttctccatcagtgac
gagatgtgcgtcaactacatccactactacccggccaccaagctggaggtctgcaagagc
tccgtgtcggaggagacgctcgagaactacttcatctacatgaagcgcacggagcaacag
cgcggcatccatttgaatggggcacgttcggcgaattatcggagcatcgagtggagccag
ccgcgcgtcgaccaactgtacacgatgtacatccaggagccgcttagcatgcagtgcaac
acatcggacggagggcgctttgcgagccagagctgggagggcgtggccccgacggccgtg
caaatcaaaatacccatccaccgcaagctctgtcccaactataatccgttgtggttgagg
ccgctggagaagggtgaatgcgatttgcttggcgagtgcatctactaa

DBGET integrated database retrieval system