KEGG   Drosophila persimilis: Dper_GL15175Help
Entry
Dper_GL15175      CDS       T01063                                 

Definition
GL15175 gene product from transcript GL15175-RA
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dper_GL15175
Transfer RNA biogenesis [BR:dpe03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Dper_GL15175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 550 aa AA seqDB search
MKPKKKLGVGLSREERQVLVVGEIIQELLAAHEAKKDVNLNRMKSLISSKYGLDSSPRLV
DIIAAVPQDAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPFVQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLS
EEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHLSDMLNY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVAHMMPDLPNVDFERDI
EQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTTCRDVRTREVGIQEIHNKVRPY
DIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSPDTFRPELKGDCSIVRELHVY
GSVVPVNARDPTKFQHQGFGILLMEEAERIAVEEHGSRKLAVISGVGTRNYYRKLGYALD
GPYMSKILSE
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgaaaaagaagttgggtgttggtctcagtcgtgaggagcgtcaggtgcttgtt
gtcggggaaataattcaagagcttctggccgcacacgaagccaagaaggatgtgaatttg
aaccgcatgaagtcgcttatatcttccaaatatggactagacagctcgccacgattggtg
gacataatagccgcagtgccacaggacgccaaaaagatccttctacccaaactgcgcgcc
aagcccatacgtacagcgagcggtattgccgtcgttgcagttatgtgcaagccccatcgt
tgtcctcacatcaatatgaccggcaacatctgcgtctattgtcctggcgggcctgacagc
gactttgagtactcgacgcaatcatataccggctatgagcccacctccatgcgcgctata
cgagcacggtacgatccctttgtgcagacgcgccatcgcgtcgaacagctcaagcagctg
ggtcacagcgtggacaaggtggagtttattgtaatgggcggtaccttcatgtgtctgtcg
gaggagtatcgcgactatttcatacgcaatctgcacgacgctctctctggtcacagcagt
gccaacgtggccgaggctgtacgttactctgagaaatctcgcaccaagtgcattggcatt
acaattgagacacgtccggactactgcctcaagaggcacctctcggatatgctcaactac
ggctgcacccgcctggaaattggcgtgcaatccgtctacgaagatgttgccagagacaca
aatcgtggccatacggtgcgggctgtgtgcgaaagttttcagctaggcaaagacgccggc
tacaagattgtggcccatatgatgcccgacttacccaatgtagactttgagcgtgacatt
gagcagttcatcgaatactttgagaatcctgcctttcgttcggatggcctgaaaatctat
cccactctcgtcattcgcggtaccgggctttatgagctgtggaagaccggacgctacaag
tcctatccaccctctatgctggtggatctggttgccaaaatcctggccctagtgccaccc
tggacacgagtctatcgcgtgcagcgcgacattcccatgccgttggtcagctctggggta
gagcacggtaatcttcgagagcttgccctggctcgcatgaaggatctgggtaccacatgt
cgtgatgtaaggacacgcgaggtcggcatccaggagattcacaacaaagttcgaccctat
gacatagagctaatccgacgcgattatgtggcaaatggaggttgggaaacgttcctctcg
tatgaggatcccgaacaggatatactcgttggtctactgcgtctgcgcaaatgttcgcca
gataccttccggccggagctgaagggcgactgttccattgtgcgggaattgcacgtttat
ggctcggtagttccggtgaacgctcgtgatcccaccaagttccagcatcagggattcggt
atactgctgatggaagaggcggagcgaattgcagtcgaagagcatggcagccgcaagctg
gcggtcatctcgggtgtcggcactaggaactattaccggaagctgggctacgcgctggac
ggaccctacatgtcgaagatcctatcagaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system