KEGG   Drosophila persimilis: Dper_GL15175Help
Entry
Dper_GL15175      CDS       T01063                                 

Definition
(RefSeq) GL15175 gene product from transcript GL15175-RA
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dper_GL15175
Transfer RNA biogenesis [BR:dpe03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Dper_GL15175
Chromosome and associated proteins [BR:dpe03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dper_GL15175
   HAT complexes
    Elongator complex
     Dper_GL15175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 6595521
NCBI-ProteinID: XP_002020626
FlyBase: FBgn0152779
UniProt: B4GPU7
AA seq 550 aa AA seqDB search
MKPKKKLGVGLSREERQVLVVGEIIQELLAAHEAKKDVNLNRMKSLISSKYGLDSSPRLV
DIIAAVPQDAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPFVQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLS
EEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHLSDMLNY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVAHMMPDLPNVDFERDI
EQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTTCRDVRTREVGIQEIHNKVRPY
DIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSPDTFRPELKGDCSIVRELHVY
GSVVPVNARDPTKFQHQGFGILLMEEAERIAVEEHGSRKLAVISGVGTRNYYRKLGYALD
GPYMSKILSE
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgaaaaagaagttgggtgttggtctcagtcgtgaggagcgtcaggtgcttgtt
gtcggggaaataattcaagagcttctggccgcacacgaagccaagaaggatgtgaatttg
aaccgcatgaagtcgcttatatcttccaaatatggactagacagctcgccacgattggtg
gacataatagccgcagtgccacaggacgccaaaaagatccttctacccaaactgcgcgcc
aagcccatacgtacagcgagcggtattgccgtcgttgcagttatgtgcaagccccatcgt
tgtcctcacatcaatatgaccggcaacatctgcgtctattgtcctggcgggcctgacagc
gactttgagtactcgacgcaatcatataccggctatgagcccacctccatgcgcgctata
cgagcacggtacgatccctttgtgcagacgcgccatcgcgtcgaacagctcaagcagctg
ggtcacagcgtggacaaggtggagtttattgtaatgggcggtaccttcatgtgtctgtcg
gaggagtatcgcgactatttcatacgcaatctgcacgacgctctctctggtcacagcagt
gccaacgtggccgaggctgtacgttactctgagaaatctcgcaccaagtgcattggcatt
acaattgagacacgtccggactactgcctcaagaggcacctctcggatatgctcaactac
ggctgcacccgcctggaaattggcgtgcaatccgtctacgaagatgttgccagagacaca
aatcgtggccatacggtgcgggctgtgtgcgaaagttttcagctaggcaaagacgccggc
tacaagattgtggcccatatgatgcccgacttacccaatgtagactttgagcgtgacatt
gagcagttcatcgaatactttgagaatcctgcctttcgttcggatggcctgaaaatctat
cccactctcgtcattcgcggtaccgggctttatgagctgtggaagaccggacgctacaag
tcctatccaccctctatgctggtggatctggttgccaaaatcctggccctagtgccaccc
tggacacgagtctatcgcgtgcagcgcgacattcccatgccgttggtcagctctggggta
gagcacggtaatcttcgagagcttgccctggctcgcatgaaggatctgggtaccacatgt
cgtgatgtaaggacacgcgaggtcggcatccaggagattcacaacaaagttcgaccctat
gacatagagctaatccgacgcgattatgtggcaaatggaggttgggaaacgttcctctcg
tatgaggatcccgaacaggatatactcgttggtctactgcgtctgcgcaaatgttcgcca
gataccttccggccggagctgaagggcgactgttccattgtgcgggaattgcacgtttat
ggctcggtagttccggtgaacgctcgtgatcccaccaagttccagcatcagggattcggt
atactgctgatggaagaggcggagcgaattgcagtcgaagagcatggcagccgcaagctg
gcggtcatctcgggtgtcggcactaggaactattaccggaagctgggctacgcgctggac
ggaccctacatgtcgaagatcctatcagaatga

DBGET integrated database retrieval system