KEGG   Drosophila persimilis: Dper_GL15210Help
Entry
Dper_GL15210      CDS       T01063                                 

Definition
GL15210 gene product from transcript GL15210-RA
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 568 aa AA seqDB search
MESEKILMAAGVTVAAVVGAFVLWGPSGARLRQRRGQIAGLHNFGRTCFLNTLLQALAAC
PQFIAWLQLYNGASPDRKSLISSMLNTLEVINGTHTTLRGDPHSPGAVLRALNTLGWVIP
QEEHDAHELFHVLLSSLEEEAIRPQPLGCLSDALPGPPGHDDDSSSSIGIETPAGGGFRP
LNSVAVGVGASQRMGDQPNRPSSAMLTDFLNMDYDESTNLTRLVRSEAHTPDSPASVCER
EGNDRIGSLLDAISPGTSLMGQQPFGFPLCSEALAIDSLTTPTVGGGERLSRPRQPQSQE
VGEGLNRRVSASCRSLERLHRGPGRVSIWSNMMPSQVAHPFQGAMGAQLVCNGCGSKSSV
RYDKFDSIILNLPTQRRTGLSLGHLLSEYITSEDLSDVKCDSCNETTTHTKSVTFAKLPG
CLCIHIARTVWLPTGQVCKRRDYVHFPESLSMAPYSFVQPHLNSQATTPWGSTMSLFSSS
LPMNNAVGGVEGFGTMFPKNLYRLLAVVVHTGEANSGHFVTYRRGSLRNAHRWFYTSDTI
VREVTIDEVLSVPAYLLFYDRGQQRPMR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgagaagatattgatggctgctggtgtgacggtagctgccgtcgtaggagcc
tttgtactctggggaccatcaggtgcccggttgcgtcagcgtcgtggccagatcgcaggg
ctccacaacttcggacggacatgcttcctcaatacgcttctccaggctctagccgcgtgc
ccgcagttcatagcctggctgcagctctataatggagcatcgccggatcggaaaagcttg
atcagttccatgctgaacaccctggaggtaattaatggtactcatactacactgcgtggc
gacccgcactcacccggcgccgttctgcgggcccttaacaccttgggctgggtcattcca
caagaggagcatgatgcccatgagttgttccatgtactgctgtcttcgttggaggaggag
gccattcgcccacagccattgggatgtctatctgatgcgctgcccggtcccccgggccat
gatgacgatagcagcagcagcattggaatcgaaacaccggctggcggcggcttcaggccg
ctgaactctgtggccgtgggcgtcggtgcgagccagcggatgggggatcaaccgaatcgc
ccgtccagcgctatgctcactgattttctcaacatggactacgacgagtcgaccaatctg
acgcgcctggtgcgctccgaggcccacacccccgactcgccggcgtcggtttgcgagcgc
gagggaaacgatcgaatcggatccctgctagatgcgatctcgcctggcacatcgttgatg
ggacagcagccgttcggatttcccctctgtagcgaggccctggctattgattctctgacc
acgcctactgtgggaggtggggagcgtttgtcgcgccctcgccagccacagtcgcaggag
gtgggtgagggcctcaataggcgggtgtcggcatcctgccggtcgctagagcgtctgcat
cgtgggcccggacgagtatcaatctggtccaacatgatgcccagccaggtggcccatccc
ttccagggagcaatgggcgcccagcttgtatgcaacggctgcggctccaagtcctcggtg
cgctacgataaatttgatagcatcatcctgaacttgccgactcagcgtcgcaccgggttg
agcttgggccaccttctcagcgaatacattacgtcggaggacctgagcgacgtcaagtgt
gactcgtgcaacgagaccaccacacacacaaagtctgtaacgtttgccaagcttcctggc
tgcctgtgcatccatatagcccgaaccgtttggctgcccacgggacaggtgtgcaagcga
cgagactatgtccactttcccgagagcctatccatggcaccctacagcttcgttcagcct
cacctcaacagccaggccaccacaccctgggggtcaacgatgtccctattttcttcaagc
ctaccgatgaacaatgccgtaggtggtgtcgaaggattcggcacgatgttccctaagaat
ctgtaccgtctgctggccgtggtggtgcacacgggcgaggccaatagcggacactttgtc
acctatcggcgtggctcgcttaggaatgcccatcgatggttctacacatcggacacgatt
gtgcgcgaggtgaccatcgacgaggtgctcagtgtgccggcgtaccttctgttctatgat
cgaggacagcagcgcccaatgcgctag

DBGET integrated database retrieval system