KEGG   Drosophila persimilis: Dper_GL15211Help
Entry
Dper_GL15211      CDS       T01063                                 

Definition
GL15211 gene product from transcript GL15211-RA
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dper_GL15211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1153 aa AA seqDB search
MSEEEVEHSREEEFSREEAFSRNEERPHEEEQLRGKKGSRDEENSRDQDYSRDEERSFEE
DRSRDEDHETSREEAQEHLRVDHQEHPREEEQELSREEENSHEEEHSRGEENSHEEENSH
EEEHSHEEEHSHEEEHSHEEEHSHEEEHSHEEEHSREEENSHEEEHSLVEEHSHHKQNLP
HEELSRDEEPSTNQEHSRNEENSGDEWLLRDEQQSCYEEHLPVDVDETSRDGEHLRGPGA
LTDRQSSPYEVAPYEDPPRPPQYEEQSRYLDVTTDCYMVEVDSEEKSTAAHEEADVNALE
IVDQPASEGAEPDQSIDMSCVNTALEADEDGEPPAKREKPHYENSPVTEDSSSSSSTSSG
SDSSSHSDDYDDSTKDDASVDTVIYVEDLPPTISYPRMDPDAPTKPIITEVVTIPAPRVN
LLRYPMPNIQHHMPPPPPRRPVDSEPELDPDDYDGAVAMPGLPAKDCGDNINLPPYIPDH
YISPRAEQQPEQESTRHQFIYPRQPLDYQSQQRAGVQSVQDNQQFVYPRQPLDYPAQQRT
QLPLDQQFVYPRQPLAFPPQAQSEQDKDKYPPPRVPARQLIDSYKIKHRPPSGDRRRMPP
PGPMRTVLGAEMENISDDDEISDAEESSSSDGSSSENESEDEDDDYILIENDSNSAGTET
ETEIMAGSGDLGDGIVVNEDSEKVYYIRREDGTVHAGRVLQSRITANVLMPNEYYVHYVG
LNRRLDEWVGRHRISDNADDLGGITETASSLLQLDSDQPGTSREMLQQQALLAQQQQILL
QQQQQQRELEKERALREGNKDYYLSACENTRYDYSDRKMTRYQKRRYDEINHVQKSHAEL
TASQAALEKEHESITKIKYIDKLQFGNYEIDTWYFSPFPGDYGKARTLYVCEYCLKYMRM
RKSYSYHTYVCRKRHPPGREIYRKGNISIFEVNGKEEPLYCQLLCLMAKLFLDHKVLYFD
MDPFFFYILCEVDREGSHIVGYFSKEKKSPDNNNVACILVLPPHQRKGFGKLLIAFSYEL
SRREGVIGSPEKPLSDLGRLSYRSYWAYTLLELMRNRVSLEQTTIKELSEVSGITHDDII
YTLQSMKMIKYWKGQNVICVTTKTIFDHLLLPQFKKPKLTIDRSYLFWNPTNMPAPARPP
LPINATALGQIAV
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggaggaggtggaacattcgcgcgaggaagagttctcgcgcgaggaagcgttc
tcgcgcaacgaagaacgcccccacgaagaggaacaattgcgcggaaaaaaaggatcgcgc
gacgaggaaaactcacgcgaccaagactactcacgcgacgaggagcgctccttcgaggag
gataggtcgcgtgacgaggaccacgaaacctcgcgcgaggaggcgcaggagcacttgcgc
gtggatcaccaggagcacccacgggaggaggagcaggaactctcccgcgaggaggagaac
tcgcacgaggaagaacactcccgaggggaggagaactcgcacgaggaggagaattcgcac
gaggaggagcactcgcacgaggaggagcactcgcatgaggaggagcactcgcacgaggag
gagcactcgcacgaggaggaacactcgcacgaggaggaacactcccgcgaggaggagaac
tcgcacgaagaggagcactcgcttgttgaggaacactcccaccataagcaaaacttgccc
cacgaggaactttcgcgagacgaggaaccctcaacgaaccaagagcactcgcgcaacgag
gaaaactccggtgacgaatggctcttgcgcgacgaacagcaatcatgctacgaggaacac
ttgcccgttgacgttgatgagacctcacgcgacggggaacacttgaggggtccaggagca
ctcacagacagacaatcttcgccctacgaggtagcaccatacgaggatcccccgcgccca
ccgcaatacgaggaacaatcgcggtatttggatgtcacgaccgactgctatatggttgaa
gttgattctgaagaaaaaagtacggcggctcacgaggaagccgatgtgaatgccttggag
attgttgatcagccagcctcggagggcgcggagccggatcagtccattgacatgagttgt
gtcaataccgcactggaagccgacgaggatggagagccgccagctaagcgggaaaagccc
cactacgagaacagccccgtgacggaggacagcagtagcagcagctcgacctcgtccggt
agcgacagcagctcgcactctgatgattacgacgattcaaccaaagacgatgcttccgtg
gacactgtcatctatgtggaggatctgcccccaaccattagctaccctaggatggatcct
gacgctccgaccaaaccaattatcaccgaggtggtgactattcccgccccgcgggtgaat
cttttgcgttatccaatgccgaatatccagcaccatatgcccccgcctccgcctcggcgg
ccggtcgattccgagcccgagcttgatcccgatgactatgatggagcggtggcaatgccc
ggcctgccagccaaggattgcggtgataatattaatctccctccttatatcccagatcac
tatatatccccgcgcgccgagcagcagccggagcaggagagtacacgccaccagtttata
tatccgcgccagccgcttgactaccagtcccagcagcgcgccggcgtccaatcggtgcag
gataaccagcagttcgtctatcctcgccagccgcttgactatccagcacaacagcgcacc
cagctgccgctggatcagcagtttgtgtacccgcgccagccgcttgcatttccgccccag
gcgcagtcggagcaagacaaggataagtatccgcccccgagggtaccggcgcgtcagctg
attgattcctataaaattaaacacagaccaccgtcgggcgatcgacggcgtatgccaccg
ccagggcccatgcgcactgtgctcggtgcggaaatggagaacatttcggatgatgatgag
ataagcgacgctgaggagagtagcagcagcgacggcagcagcagcgagaacgaatctgag
gacgaggatgatgactacatcctgattgagaatgacagcaactcggctgggacggagacg
gagacagagataatggccgggtcgggtgatctaggcgatgggatcgtggtcaacgaggat
tccgagaaggtgtactacattcggcgcgaagacggcaccgtccatgccggccgtgtgctc
cagtcgcgcatcaccgcgaacgtcctgatgcccaacgagtactacgtgcactatgtgggc
ctcaatcgccgcctggacgagtgggttggtcgccaccgcatctcggacaacgccgatgac
ttgggaggcatcacagaaaccgccagcagcctcctccaattggacagcgatcagccggga
accagtagagagatgctgcagcagcaggcgcttctcgcgcagcaacaacagattttattg
cagcagcaacagcaacagcgcgagctggaaaaggaacgagccctgcgcgagggcaacaag
gactactatctgtcggcgtgcgagaatactcgctacgattacagtgaccggaagatgacg
cgctaccagaagcggcgttacgacgagatcaaccacgtgcagaagagccatgcggagctg
accgcctcgcaggcggccctcgagaaggagcacgagtccatcacgaagatcaagtacatc
gacaagcttcagttcggcaactacgagatcgacacctggtacttcagcccctttcccggc
gactacggcaaggcgcgcacgctgtacgtgtgcgagtactgcctgaagtatatgcggatg
cggaagagctacagctaccatacgtatgtgtgccgcaagcggcatccgccgggtcgcgag
atctaccgcaagggcaacatctccatttttgaggtgaacggcaaggaggagcccctctac
tgtcagctgctctgcctgatggccaagctctttctcgaccacaaggtgctgtactttgat
atggatccgttcttcttctacattctgtgcgaggtggacagggaaggcagccatattgtt
ggctatttctccaaggagaaaaaatccccagacaacaacaacgtggcatgcattttagtc
ctgccgccgcatcagcgcaaaggcttcggcaagctgttgatcgccttcagctacgagctg
tcccgcagggagggcgtcattggaagcccagagaagccgctgtcggacctcggtcgactc
agttaccgcagctactgggcctatacgctattggagctgatgcggaaccgcgtttcgctg
gagcagaccaccatcaaggagctgagtgaggtgagcggcattacccacgacgacatcatc
tacacgctgcagtccatgaagatgatcaaatattggaagggccagaacgtcatatgtgtc
acaaccaagacgatcttcgaccacctactgctgccgcagttcaagaagcccaagctgact
atcgatcgcagctatctgttctggaaccccaccaacatgccggcgccagcccgacctccc
ctgccaatcaatgccacagcacttggtcagattgcggtctaa

DBGET integrated database retrieval system