KEGG   Drosophila persimilis: Dper_GL15340Help
Entry
Dper_GL15340      CDS       T01063                                 

Definition
GL15340 gene product from transcript GL15340-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dper_GL15340
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dper_GL15340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 768 aa AA seqDB search
MARPMDDREREAIVQSLHKDVLSLKEMVRNRESELVKLHREIHKLKSVLQQTTNHLNVTR
NERNERLQQSPTKTKLYSLPEQCGEVTSSHANPHLCTSCGMVLPSSPELAMEALSLGPPT
GKTTDTTATTAAPEMRPKPLPAAIKKQGVSAERCVQSMQQSYSAPIPNDKQQIKDAIMDN
DFLKNIDASQVRELVDSMYSKSIAAGEFVIREGEAGAHLYVSAAGEFAVMQNGKVLDKMG
PGKAFGELAILYNCTRTASIRVLSESRVWVLDRRVFQQIMMRTGLQRIENSVNFLRSVPL
LRNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPNALEETE
LRTLSRGDYFGEQALINEDKRTANIIALPPGVECLSLDTDSFKRLIGDLCELKEKDYGDE
SRMLAMKAAAHSHEVLGAQAQAQQHQQEFPDLRLTDLEVVSTLGIGGFGRVELVKAHHQG
RVDTFALKCLKKRHIVDTKQEEHIFSERTIMLSSHCPFICRLHRTFRDEKYVYMLLEACM
GGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENLMLDERGYVKLVD
FGFAKHIGTSAKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGTPPFSASD
PMQTYNLILKGIDMIDFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGF
DWDGLASQLLIPPFVRPIAHATDVRYFDRFPCDPVEPPDELSGWDADF
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggcccggccaatggacgatcgggagcgcgaggcgattgtccagagcctgcacaaggac
gtgctgtccctcaaggagatggtgcgcaatcgagagagcgagctggtcaagctgcaccgg
gaaatccacaagctgaagagcgtgctgcagcagaccaccaaccatctgaatgtgaccagg
aatgagcggaacgagcggctgcagcagtccccgaccaagacgaagctctactccctgccc
gagcagtgcggcgaggtgaccagcagccatgcgaatccgcacctctgcacctcctgcggc
atggtgctgcccagcagcccagagcttgccatggaggcactctctctggggccacccaca
ggcaaaaccacagacacaacggcaacgacagcagcccctgagatgcgtcccaagcccttg
ccggcggccatcaagaagcagggggtgtccgccgagaggtgcgtccaatccatgcagcag
tcgtacagcgccccgattcccaacgataagcagcagatcaaagacgccatcatggacaac
gacttcctcaagaacatagacgcctcgcaggtgcgcgagctggtggactcgatgtactcc
aagagcatagcggccggggagtttgtcattcgcgagggcgaggcgggggcccacctgtac
gtgtccgccgccggggagtttgcggtgatgcagaacggcaaggtgctggacaagatgggg
ccgggcaaggccttcggggagctggcgatcctctacaactgcacgcgcaccgcctccatc
cgcgtgttgagcgaatctcgggtgtgggtgctggaccgacgggtcttccagcagatcatg
atgcgcacgggcctgcagcggatcgagaacagcgtcaacttcctgcgatcggtgccgctg
ttgcggaatctcagcgaggagctgctggccaagatcgccgacgtgctcgagctggaattc
tacgccgctgggacgtacatcatccggcagggcaccgccggcgacagcttcttcctgatc
tcgcagggcaacgtgcgggtgacccagaagctgacgcccaacgcgctggaggagacggag
ctgcgcaccctctcgcgcggcgactacttcggcgaacaggcgctcatcaacgaggacaag
cgcacggcgaacattatagcccttccgccgggcgtggagtgcctctccctggacactgac
tccttcaagcggctgatcggggacctgtgcgagctgaaggagaaggactacggggacgag
agccgcatgctggccatgaaggcggccgcccacagccacgaggtgctcggcgcgcaggcg
caggcgcagcagcatcagcaggagttccccgacctgaggctcacggatctcgaggtggtc
agcaccctgggcatcgggggcttcggccgcgtggagctggtcaaggcgcaccaccagggc
cgcgtggacaccttcgccctgaagtgcctgaagaagcggcacatcgtggacaccaagcag
gaggagcacatcttcagcgagcgcaccatcatgctcagctcccactgtccgttcatctgt
cgcctgcaccgcaccttccgcgacgagaagtacgtctacatgctgctggaggcctgcatg
ggcggcgagatctggaccatgctgcgggaccgagggtccttcgaggacaacgccgcccag
ttcatcatcggctgtgtgctgcaggccttcgagtacctgcacgcccgcggcatcatctac
cgcgacctcaagcccgagaacctgatgctggacgagcgcggctacgtgaagctggtggac
tttggcttcgccaagcacataggcaccagcgccaagacgtggaccttctgcggcacgccc
gagtacgtggcgcccgagatcatcctcaacaagggccacgatcgcgccgtcgactactgg
gccctgggcatcctgatccacgagctgttgaacggaacgccgccgttcagtgcctcggat
cccatgcagacgtacaacctcatcctcaagggcatcgacatgatcgacttccccaagcac
atctcccgctgggccgtgcagctgatcaagcgcctctgccgcgacgttccctcggagcga
ctgggctaccagacgggcggcatacaggacatcaagaagcacaagtggttcctgggcttc
gactgggatgggctggccagccagctgctgattccgcccttcgtgcggcccatcgcccat
gccacggacgtgcgctacttcgatcgcttcccctgcgaccccgtcgagccgccggacgag
ctctccggctgggatgccgacttctag

DBGET integrated database retrieval system