KEGG   Drosophila persimilis: Dper_GL15523Help
Entry
Dper_GL15523      CDS       T01063                                 

Definition
(RefSeq) GL15523 gene product from transcript GL15523-RA
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
dpe  Drosophila persimilis
Pathway
dpe00010  Glycolysis / Gluconeogenesis
dpe00052  Galactose metabolism
dpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dper_GL15523
   00052 Galactose metabolism
    Dper_GL15523
Enzymes [BR:dpe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dper_GL15523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 6601471
NCBI-ProteinID: XP_002026438
FlyBase: FBgn0153127
UniProt: B4H6F9
AA seq 365 aa AA seqDB search
MVHVTEDVFATGAVNPFTKQTEPIRRFTLSNGSRMSVQVITLGATITSVKTEDARGQLDD
VTLGFDDLEGYQSEKNPYFGATIGRVCNRVANGRFRLDGEVVEVSKNRDNKFQLHGGFVG
FDKAHWDVVSVRQDGVTLSHTNPDGHEGYPGKVTATVNFTLSEDNCLHVRMMAESDKPTP
VNLTNHSYFNLAGHKAGANGLYEHTIEINAYGITETDKDSIPTGKITLVDGTFFDLRVPN
NLGERLKQLQPARGYDDNFCVEFDPPQPFSKVARATHPPSGRWLEVVSNQPGVQFYTANF
MPDVERGEAAIPGKSGAAYAKHGAFCLETQKFPDSVNHSNFPIDDLAPRRGPTTTKSSTS
LGVSQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggttcacgtcaccgaggatgtttttgctactggagcagtcaatccatttaccaagcaa
acggaacccattcgacgctttacgctatccaatggcagtcgcatgtcggtccaggtgatc
accctgggcgccaccatcaccagcgtcaagacggaggatgcccgcggccagctggacgac
gtcacgctcggatttgacgacttggagggttatcagagcgaaaagaatccctactttggg
gccaccattggacgtgtgtgcaatcgtgtagctaacggacgcttcaggctggatggcgag
gtggtggaggtgtccaagaatcgggataacaaattccagttgcatggcggattcgtgggc
ttcgacaaggcccactgggatgtggtttcggtgcgtcaagacggcgtcacactatcgcac
accaatcccgatggccatgaaggttatccgggcaaggtcacggccacagtgaactttacc
ctcagtgaggacaactgcctgcatgtccggatgatggcggagagtgacaagcccacgccc
gtgaatctcacaaaccactcgtacttcaacctggctggccacaaggcgggtgccaacggt
ctctacgagcacaccatcgagatcaatgcctatggcatcaccgaaacggacaaggactcc
atacccaccggtaagatcacactggtggacggaacttttttcgatctgcgcgtgcccaac
aatctcggggagcgcctcaagcagctgcaaccggcccgtggctatgatgataatttctgt
gtggagtttgatccgccacagcccttctctaaagtggccagagcaacgcatccacccagt
ggacgctggctggaggtggtcagcaatcagccaggcgttcagttttatacggccaacttt
atgccggacgtggagcgtggagaggcggccattcccggtaagagtggagcagcctatgcc
aagcatggagccttctgcctggagacccaaaagtttcccgattctgtgaatcacagcaac
tttcccatcgacgaccttgcgccccggcggggacctacaaccacgaagtcatctacaagt
ttgggcgtctcccaataa

DBGET integrated database retrieval system