KEGG   Drosophila persimilis: Dper_GL15523Help
Entry
Dper_GL15523      CDS       T01063                                 

Definition
GL15523 gene product from transcript GL15523-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dpe  Drosophila persimilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dper_GL15523
   00052 Galactose metabolism
    Dper_GL15523
Enzymes [BR:dpe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dper_GL15523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 365 aa AA seqDB search
MVHVTEDVFATGAVNPFTKQTEPIRRFTLSNGSRMSVQVITLGATITSVKTEDARGQLDD
VTLGFDDLEGYQSEKNPYFGATIGRVCNRVANGRFRLDGEVVEVSKNRDNKFQLHGGFVG
FDKAHWDVVSVRQDGVTLSHTNPDGHEGYPGKVTATVNFTLSEDNCLHVRMMAESDKPTP
VNLTNHSYFNLAGHKAGANGLYEHTIEINAYGITETDKDSIPTGKITLVDGTFFDLRVPN
NLGERLKQLQPARGYDDNFCVEFDPPQPFSKVARATHPPSGRWLEVVSNQPGVQFYTANF
MPDVERGEAAIPGKSGAAYAKHGAFCLETQKFPDSVNHSNFPIDDLAPRRGPTTTKSSTS
LGVSQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggttcacgtcaccgaggatgtttttgctactggagcagtcaatccatttaccaagcaa
acggaacccattcgacgctttacgctatccaatggcagtcgcatgtcggtccaggtgatc
accctgggcgccaccatcaccagcgtcaagacggaggatgcccgcggccagctggacgac
gtcacgctcggatttgacgacttggagggttatcagagcgaaaagaatccctactttggg
gccaccattggacgtgtgtgcaatcgtgtagctaacggacgcttcaggctggatggcgag
gtggtggaggtgtccaagaatcgggataacaaattccagttgcatggcggattcgtgggc
ttcgacaaggcccactgggatgtggtttcggtgcgtcaagacggcgtcacactatcgcac
accaatcccgatggccatgaaggttatccgggcaaggtcacggccacagtgaactttacc
ctcagtgaggacaactgcctgcatgtccggatgatggcggagagtgacaagcccacgccc
gtgaatctcacaaaccactcgtacttcaacctggctggccacaaggcgggtgccaacggt
ctctacgagcacaccatcgagatcaatgcctatggcatcaccgaaacggacaaggactcc
atacccaccggtaagatcacactggtggacggaacttttttcgatctgcgcgtgcccaac
aatctcggggagcgcctcaagcagctgcaaccggcccgtggctatgatgataatttctgt
gtggagtttgatccgccacagcccttctctaaagtggccagagcaacgcatccacccagt
ggacgctggctggaggtggtcagcaatcagccaggcgttcagttttatacggccaacttt
atgccggacgtggagcgtggagaggcggccattcccggtaagagtggagcagcctatgcc
aagcatggagccttctgcctggagacccaaaagtttcccgattctgtgaatcacagcaac
tttcccatcgacgaccttgcgccccggcggggacctacaaccacgaagtcatctacaagt
ttgggcgtctcccaataa

DBGET integrated database retrieval system