KEGG   Drosophila persimilis: Dper_GL15609Help
Entry
Dper_GL15609      CDS       T01063                                 

Definition
GL15609 gene product from transcript GL15609-RA
Orthology
K15293  
protein unc-13
Organism
dpe  Drosophila persimilis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2438 aa AA seqDB search
MVFFQHYVPHDYFYNEKNDALSTNSHQPNNSNNPYRVNDNSEYYDEYSDLRNPLNHPLNY
GSERIWTSETELTHVDSSYNNDYVDYYSKEDQQGVKGEAADNWDGNNTVITAEYGFEYGN
QKCTSTKLLPLLPANQNDSSNGVANGSTVRGDIGMEMDLEGMYMYPQRENTSHHGACLPN
HDSAKDHGSGAYQNVYENNLNGHTGYAPTITDNRVPAAPLRVLPRTRARRVQRSSLSQNL
FDLNADSTYAEDPSIGDLTMTALCMAPPTEATGTITYDAFGQMARPYTSMLPLDYTHYQE
SNYNADSLSTYSDTPPNTTANAQHKLQQQRKISLMMAMTTASVIASGETRVPVQNSSKPE
ERTTATESLLGASTSTNATAIASGWWSETKFCSGEVLTSTPITAMTMTSTTTRKLPKLLP
TPQYKSSTLYTTASLASDETSGSSLQSSAPIVEKNHRPKQLPKLPTSQFQAKKHSKLLSN
LNASTAPASVASLPFSSLDDTAAFRSSPEAEAESFSMLTTTNLLSHTSQSPQPYYAVVSK
ENETNEVDLTSSENDIVLKSWAVSPPVPLEPHPCPSRELPCSVSLQMQLKNSPIAGTPEK
ESTDSYLNLKMEPSLIKPVPSSEILAATITESSSHISKPDATIFDISEYLKPYTLDAISY
SREHEEDHITIAVSTTKTIDPSYGHENLKNDDFFDSSQPQASLQKISSIYIDDEIYDVSP
FIEVSDNTETNVPTSKMAKIETTLASTAGTPTKTTATNSRGGGVWVAQQSLDIPSNLGYG
SREDDDCRSQHSGRTLSSSRRQSTEDSIDTDDEYFCYELRQLEQLEHQRTAHADNITSKQ
SADNQVVFSQIGQLLDSEVPGEHFDFAEAEVSHIYSPDESVKLRMSKVLDELKYSVKLEP
EINYGSYLNTAANTGEALTKSKPVRDRFEIVCDMHSAWQDVNGDFQQATSDMESQEDTEM
AAKEGEVATLIREKEKTQQLKRLKKRKRVPKTNKHDNKANTSSSSASENESEQNQRYITD
AVSVSDKHISIEIFQGSSASSATSGPDTPAELSDDMEKDLIIEGESHNRSSGMSGKGVFT
IEHRQSGDMFNTMSPNEHDPVSVTTTILAQPIDQCNKQTSSPQSDRGSFSSQPRPMKLIS
QESSVEGSQVIGSNGATAGLGSSKWKLLKTLKERKIEEKNNQDKIKEEEMTKDREKNGGG
TGDVGIRANGHPGDNPFYSNIDSMPDIRPRRKSIPLVSELVLKTMAATKRNAGLTSAVPR
ATLNDEELKMHVYKKALQALIYPISSTTPHNFLLWTATSPTYCYECEGLLWGIARQGVRC
TECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSIITAMKERMKQREREKPEIFEL
IRAVFSVEEKSHTGHMKAVKQSVLDGTSKWSAKIAITVICAQGLIAKDKSGTSDPYVTVQ
VSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDF
LGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHE
NLFHYLCEENSGMVKLPTQKGDDAWKLYFDEIPEEIVDEFSMRYGIENIYQGMTHFHCLS
AKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLR
IDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLR
STYQFLFENCYELYNREFQVDPNEAKRAPDDHEPKLDSVDFWHKLIALIVSVIDEDKNSY
GTVLNQFPQELNIGQLSASSMWHLFAVDMKYALEEHEQHRLCKSSAYMNLHFRVKWLYSN
YVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHGAFNRDKKDGFTKSSEHALFS
NSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRRFAKTIVKVLIAYADIVKIEFPEHMRD
ERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKELQQNLNSALDDLASQFAISL
EPRITQSVRELGDMLLSIKGGCGNLTAGNQAAQRNAVAVEADDVLRPLMDLLDGSLTLYA
QSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFKHLTDNAKNLASNAKIEDMGR
LFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDVALDTIKQYFHAGGNGLKKTF
LEKSSELQSLRYALSLYTQMTDTLIKTFISSQVHEVDPENAEESVGEISVQIDLFSHPGT
GEHKVNVKVVAANDLKWQIPSGMFRPFVEINLIGPHLQEKKRKFATKSKSNNWSPKYNES
FSFAIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLKDISEKGSVACWLPLQRRIEM
DETGWTILRILSQRNNDEVAKEFVKLKSEIRQEPTVGT
NT seq 7317 nt NT seq  +upstreamnt  +downstreamnt
atggttttcttccagcattatgtaccgcacgactacttctataatgaaaaaaatgatgcc
ttatcaacaaacagtcatcaaccaaacaacagcaataatccctatagggtaaatgataac
tcggagtactacgatgagtacagtgatctaagaaacccactaaaccatccgctaaattat
ggtagtgagcggatttggaccagtgaaacagaacttacacatgtagatagcagctataat
aacgactatgtagattactatagtaaggaagaccaacaaggtgtgaaaggagaagctgcc
gacaactgggatggaaataatacggttatcacagctgaatatggctttgaatatggaaat
caaaaatgtacctcaacaaaattattgcctttgctgccggccaatcaaaatgatagtagt
aacggtgtcgcgaacgggtcgactgttcgaggtgacattggaatggagatggatctggaa
ggtatgtatatgtacccgcaaagagaaaacaccagccaccatggtgcctgcttgcccaat
catgacagtgcaaaagaccatgggtcaggcgcctaccagaatgtctacgaaaataatctc
aatggacatactggctatgcaccaacaattacagataatagggtgccagcagcaccattg
cgtgtcttgccgagaacacgagcacgacgagttcagcgctcaagtttaagtcaaaattta
tttgatttaaatgcagattcaacatacgcagaagatccatctataggtgacctaaccatg
acagcactttgtatggccccacctacagaggccactgggaccatcacctacgacgcattc
ggacaaatggcaaggccttacacttctatgttgccattagactacactcattaccaagag
agcaactacaatgcggacagtctgtcaacgtacagcgatacaccgccaaacacgacagct
aacgcacaacataaattacagcagcagcgtaaaatttctctgatgatggcaatgacaacg
gcgtctgtaatagcatctggtgagactagggtaccagttcaaaactctagtaaaccagag
gagagaactacagctacggagtctctactaggcgccagtaccagtaccaatgccactgca
atagcttcaggatggtggtcagagacaaagttttgcagtggggaagttcttactagtact
cccatcactgctatgacgatgacatcgacgacaactagaaaattgccaaaacttctacca
acgccacagtacaaatcatcaacattgtatacaaccgcctccttagcctcagatgaaaca
tcaggttcctcattacaatcttcagcacccatcgtagagaaaaatcatcgtccaaagcag
ctcccaaagttgccaacttcccaattccaggccaaaaaacattccaagttactttccaat
ttgaacgcgtcgactgctcctgcatcagtggcatcattaccatttagttctttagacgac
acagcagcctttcgctcatcaccggaagctgaagcggaaagcttttcgatgcttacaacc
accaacttactaagccacactagccaaagcccacaaccttattatgctgttgttagtaag
gaaaacgaaaccaatgaagtagatttgacatcgtccgaaaatgatatagtgctgaaatct
tgggcagtatcacctccagtacccttagaaccccatccttgtccgtcaagggagctgcct
tgcagtgttagtctgcagatgcagctgaagaattcgccaatagccggcactcctgaaaaa
gaatcgactgattcctacctgaatttaaaaatggagccatcattgataaaaccagtacca
agctcagagattttagctgcgaccataactgaatcatcctcccacattagcaagcccgat
gcaaccatttttgacatatctgaatatctaaagccttatacattagatgcaattagttat
tccagagaacatgaagaagatcatatcaccattgctgtcagcaccaccaaaacaatagat
ccctcatacggccatgaaaacctaaaaaatgatgatttctttgattcatctcagccacag
gcaagccttcagaaaataagctcaatctatattgatgatgagatctacgacgtttctccc
tttatcgaagtatccgataatactgaaacaaatgtcccaacctcgaaaatggccaaaatc
gaaactacactagcttctacagcaggcacgcctaccaaaaccacagcgactaacagccga
ggtgggggagtctgggttgcacagcaatccttggacattccaagcaatctaggttatggg
tcacgagaagatgacgactgtcgtagtcagcattccggtcgcacactctcgtcttctcgt
cgccaaagcaccgaagatagcatcgacacagacgatgaatacttttgctatgagcttcgc
cagctcgagcaactggagcatcaacgaacagcgcatgctgataacataaccagcaagcaa
agtgccgacaatcaagtggttttctcgcagattggacagctgttggatagcgaagtgccc
ggggaacattttgactttgcagaagcggaggtatcccatatttattcaccagatgaaagt
gtaaagctgcggatgtctaaagtattagatgaactgaagtactcagttaaattagagcca
gaaattaattatggcagttatttgaatacagcagccaacacaggggaagcattaacaaag
tcaaaaccagtacgggacaggttcgaaattgtctgtgacatgcacagcgcttggcaggat
gtcaacggtgattttcagcaagcaacatctgatatggaatctcaagaggataccgagatg
gctgctaaggaaggggaagtggcaactttgattcgtgaaaaagaaaaaacacagcaattg
aagcgattaaagaagcggaaacgtgtcccaaaaacaaataaacatgataataaggccaac
acaagttcatcctctgcttccgaaaatgagtccgagcagaatcaacgatatatcactgac
gcggtatcagtatcagacaaacatatttccatagaaatatttcaaggatcatcggcatct
agcgcgacatcagggcccgatacgccagcagagttgagtgatgacatggaaaaggacttg
atcattgaaggagagagtcataacagaagcagtggtatgtctggaaagggtgtatttaca
atagaacaccgacaatcgggggacatgttcaatactatgtccccaaatgaacatgaccca
gtgtcagtaaccacaaccatacttgctcaaccaattgatcaatgcaacaaacagacatcg
tctcctcagagtgatcggggatcattttcgtctcagccgcgcccaatgaagttaataagt
caagaatcaagtgtcgagggatcccaggtgataggcagtaatggcgccacggcaggtctt
ggcagcagtaagtggaagttgcttaaaactttaaaggagcgtaagatcgaggagaaaaac
aatcaggacaaaattaaagaagaagaaatgaccaaagaccgggagaagaatggtggtgga
actggagatgttggaatacgtgccaatggacatcccggcgataaccctttctatagcaat
atcgacagtatgccagatatacggccccgtcgaaagtctattccccttgtttctgaattg
gtgctcaagactatggctgccacaaaacgaaatgccggactcacatcagctgttccccgg
gcaacgcttaatgatgaagagctgaaaatgcacgtgtacaaaaaagcacttcaggctctg
atctatcccatatcatctacaacaccgcacaactttttactatggacggccacgtcacca
acatattgctacgagtgtgaaggccttctttggggaatagcacgtcagggagtgcgatgc
acagaatgtggtgtgaagtgccatgagaaatgtaaagacctgttaaatgccgactgtctt
cagcgtgctgccgagaagagttcaaaacacggtgccgaagataaagccaattccattatt
accgctatgaaagagcgcatgaagcaacgcgagcgagaaaagcccgaaatttttgagttg
attagagccgtattcagcgttgaggaaaagagtcacaccggtcatatgaaggctgtaaaa
cagagcgtcctggatggcacaagcaaatggtcggccaaaatagcaatcacagtgatttgt
gctcaaggcctgatagcgaaggataaaagcggtaccagtgatccatatgtgacggtgcag
gttagcaaggtgaaaaaacgaacgcgaacaatgccgcaggaacttaaccctgtgtggaac
gagaagtttcacttcgagtgccataattcctctgaccgcataaaagttcgcgtttgggat
gaagacaatgaccttaaatcgaaacttcgtcaaaaattgactcgagaatcagacgatttt
ttgggacaaaccataattgaagttcgtacgctctccggggaaatggatgtttggtataat
ttagaaaaacgaacggataagtcagcagtttcaggtgcaattagacttcacatatccgtt
gaaataaagggtgaagaaaaggttgctccataccatgtccaatatacatgtctgcacgag
aacctgtttcattatctgtgtgaagaaaatagcggaatggttaaattgccaacgcaaaag
ggtgacgatgcatggaaactctatttcgatgagatccccgaggaaattgtcgatgagttt
tcaatgcgctacggtatcgaaaatatctatcaaggaatgacgcattttcattgcctttct
gcgaagtatctttgccctggtgtacccgccgtgatgagcacactgttggccaacatcaat
gcgtattacgctcataccacagcttcttctgctgtctctgctagtgatcggtttgcagct
agcaattttgggaaagagaaatttgtcaaattgttggaccaactacataattctctcaga
attgacctgtcgatgtatagaaataactttcctgcctcgagtcctgaaaagttaatggac
cttaagtctactgtcgatctactgaccagcataacatttttccgcatgaaggtacaagag
ttgtccagcccaccgagagcgagtactgttgttaaagattgtgtgaaggcttgtctaaga
tccacgtatcaattcctgtttgaaaactgctacgaactttacaacagagagttccaggtg
gatccaaacgaagcaaagcgtgctccagacgaccatgagccaaaactggacagcgtagac
ttctggcacaagctaattgcacttattgtatcggtcatcgatgaggacaaaaacagctat
ggcactgtgctaaatcaatttccccaggaacttaatattggacagctgtctgcatcgtca
atgtggcatctttttgctgtggacatgaagtacgcattggaggagcacgaacaacatcgt
ctctgcaagtcttcggcgtacatgaatctccattttcgcgttaaatggctgtatagcaac
tatgtcaaggaggttccgccctacaaaggcgccgtacctgactatccagcatggttcgag
ccttttgtgatgcagtggttaaatgagaacgatgatgtttcattggaataccttcacggg
gcgttcaatcgggataaaaaggacgggtttacgaagagcagcgagcacgctttgttttca
aattcggtagtcgacgttttcacgcaattgacgcaatgtttcgatgttgttagcaagctc
gagtgtcctgatccagaaatttggaaacgttacatgaggcgttttgctaaaacaatcgta
aaagtgctaatagcctatgcagatattgtgaaaattgagtttccagagcatatgagggat
gaaagaattgcctgcatacttatgaacaacatacagcaattaagagtacagttggagaaa
atgtttgagtctatgggtggggataagctggaagaggacgcagccaatatactaaaagag
cttcaacagaatcttaattctgcactggacgatttggcctcacagtttgccattagtttg
gagcctcgaataactcagtcggtgcgtgaactaggtgacatgctgctgtctattaaagga
ggctgtggaaatctgacagctggtaaccaagccgcacagcgtaacgctgtcgccgttgag
gccgatgacgttttgaggccgcttatggacttgcttgatggttcattgacactttatgcg
cagtcttgtgaaaagacggtactaaaacgacttttaaaagaactctggaaaatcgtaatg
cgaatattggaaaaaactattgttttgccaccaatgactgataaaactatgatgtttaag
catcttactgacaatgcaaaaaaccttgcatccaacgcaaaaatagaagatatgggtcgt
ttgtttaagtctcatatggctggaaaacaggatgttaaaagtgcgcttagcggtgtcatg
gacatatcaaaggaagtggaaaaaaatttatcgcctaaacaatgtgctgtactcgatgtt
gccttagatactataaaacaatatttccacgccggtggcaatggactgaaaaagacgttt
cttgagaaatcttcagagcttcaaagtctacgatacgcactcagtttgtatacgcaaatg
accgacacacttatcaaaacctttatatctagtcaagttcacgaagttgatcctgaaaat
gcagaggaaagtgtcggcgaaatttcagtacaaatagacttattttcccacccaggcaca
ggtgaacacaaggtgaatgtgaaagtggtggctgctaatgatctgaaatggcaaatacca
tctggaatgttccgaccatttgttgagatcaacttgattgggccgcatctacaggaaaag
aagaggaagtttgcaaccaagtcaaagtcaaataactggtcgcctaaatacaatgaatca
tttagcttcgctattggtaatgaggaacagctggactttttcgagttgcatatttgcgtt
aaggactattgttttgcccgtgatgatcgacttgtcggcgtggcagttatcccgctcaaa
gacatatcggaaaagggatctgtcgcctgttggttacctttgcagagacgcatagaaatg
gacgagacgggttggacaattttacggattctatcacaacgtaataatgatgaagtcgcc
aaggaatttgttaagctgaaatcagaaatacgtcaggaaccaacagtgggtacttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system