KEGG   Drosophila persimilis: Dper_GL15669Help
Entry
Dper_GL15669      CDS       T01063                                 

Definition
GL15669 gene product from transcript GL15669-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dpe  Drosophila persimilis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dpe01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dpe01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 353 aa AA seqDB search
MPPNSYPTDTTGVLFEGDTAAATVLKKIPDPNHKLELLWLNITLFTILHVSSLYGVWLLF
TAAKWQTVVLFPAALVLTILGISGGAHRLWAHRTFKANTPLRLIFMFLNTLAFQDAVYYW
ARDHRLHHKYSETDADPYNSQRGWFFAHIGWLCCKKHPDVTIKGRDIDLSDLRNDKLVMF
QKKHYLILMPLICFVLPTVVPMYYWGESLICSWSCFTLLRWCASLNIVWLVNSSAHMYGK
RPYDKNISPTDEAFLIWFRVGEGYHNYHHVFPWDYKSAELGKYSRDATTYFIDFFARIGW
AYDLKSVSTEMLRQRIKRTGDGSHPVWGWGDKDQPQEDIADTTITHRLKVNAS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgccacccaatagctatcccacggacaccacgggcgtgctcttcgagggcgataccgcc
gcggcaacggttctgaagaagatacccgatccgaaccacaagttggagctcttgtggctg
aacatcaccctgttcacgatcctacatgtgtcctcgctgtacggcgtgtggctgctcttc
accgccgccaagtggcagacagtggtgctattccccgcggcactggtgctcaccattctg
gggatatccggaggagcccatcgcctgtgggcgcatcgcacgttcaaggccaacacgccg
ctgaggctgatcttcatgttcctcaacacgctggccttccaggacgccgtctactactgg
gcccgcgaccaccgcctgcaccacaagtactcggagacggacgccgatccctacaactcg
cagcgcggctggttcttcgcccacatcggctggctgtgctgcaagaagcatccggatgtg
acgatcaagggcagggatatcgatctctcggacctgcgcaacgacaagctggtgatgttc
cagaagaagcactacctgatcctcatgccgctcatctgcttcgtgctgcccaccgtcgtg
ccgatgtactactggggcgagtccctgatctgctcgtggtcgtgcttcaccctcctccgg
tggtgcgccagcctcaatatcgtgtggctggtgaacagctccgcccacatgtacggcaag
cggccgtacgacaagaacatctcccccacggacgaggcattcctcatctggttccgcgtg
ggcgagggctaccacaactaccaccacgtcttcccctgggactacaagagcgccgagctg
gggaagtattcgcgcgatgccaccacatactttatcgactttttcgcccgcattggctgg
gcctacgacctgaagagcgtctccacggagatgctccgccaaaggatcaagcgcactggc
gatggcagccaccccgtgtggggatggggcgacaaggaccagccgcaggaggacattgcc
gacaccaccatcacacacaggctcaaggtcaatgccagttga

DBGET integrated database retrieval system