KEGG   Drosophila persimilis: Dper_GL15831Help
Entry
Dper_GL15831      CDS       T01063                                 

Definition
GL15831 gene product from transcript GL15831-RA
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
dpe  Drosophila persimilis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dper_GL15831
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Dper_GL15831
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Dper_GL15831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 642 aa AA seqDB search
MSCFSAMNAPLLGEMEQTIGMLERGTIVTKLYGKQRRPDRRHLMLIRETRQLLWSTVAAQ
TPRTDFEGAIQLREIREIRVGKHSKEFRLFADDCQRYENSKCFVILYGNHFKLKSFSVVA
LSEIEADNWVRGLRYMVKDTVNASYPLQIDRWLRREYYQIENVNSHSAKSSEQSQTQVTI
KDFKMFLASVSCKMTTSKFMECFTDDVRRKHDLKFDDFSRLYQKLLLPHSFANILCGGTA
ASSAFPYSEDQQTVRPTELKRFLETEQRDLNVGELNSGSISGFIRDFVQDVERDVQEPYL
TLSEFVDYLFSKQNDLWNSKYDSIFMDMNMPLSSYWIASSHNTYLTGDQFSSESSCEAYA
RALRMGCRCIELDCWNGPDNLPYIFHGHTMTSKIKFMDVVKTIKDHAFTTSEYPVILSIE
QNCSLEQQRNMAQALIEVFGDMLLTQPCDRNEQHLPSPYQLRRKIILKHKKLPQYDETTF
SGVGISNGGIAAAAAGGGGGSSLTHRSSLSGGGGENEGENMRKVFKEGLLYFKDPVDKSW
NLYQFVLTQQELIYTSEISESHRNGTSEDDDFGLSSSCSLNNTMQQKQKDTSANDELHFG
ENWFHGKLEGGRKEADDLLQKYKHLGDGTFLVRESATFVGRL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcttcagtgcaatgaacgccccgctgctgggtgaaatggagcagaccattggc
atgctggagcgcggtacaattgtgacgaagctgtacggcaagcaaaggcgtccggatcgt
cgccatctaatgcttatcagggaaacgcgtcagctgctatggtcgacagtggccgcccaa
acgccccggaccgactttgagggtgcgatacagctccgcgagatccgtgagatacgtgtg
ggcaagcactcgaaggagttccggctcttcgccgacgattgccagcgctacgagaacagc
aaatgctttgtcatcttgtatggcaatcacttcaagctgaagagcttctcggtggtggcc
ctatcggagatcgaggccgacaattgggtgcgtgggctccgctatatggttaaggacaca
gtgaacgcttcgtatccgctgcagatcgatcgctggctgcgacgcgaatactatcagatc
gagaatgtcaattcgcattcggccaaatcgtcggaacaatcccagacgcaggtgaccatc
aaggactttaagatgttcctggccagcgtcagttgcaaaatgaccaccagcaaattcatg
gagtgcttcaccgacgatgtccgacgaaagcatgacctcaagtttgatgacttttcgcgt
ctctatcagaagctcctactgccgcatagtttcgccaacattctgtgtgggggaacagcc
gcatcgagtgcctttccctactcggaggatcagcagacagtgcgtcccacagagctgaag
cgttttctggaaacagaacagcgtgatctgaacgtgggcgagctcaattccgggtccata
tccggcttcatacgtgactttgtgcaggatgtggagcgcgatgtacaggaaccctatctg
acgctgtcggagttcgtcgactacctcttctcgaagcagaacgacctgtggaacagcaaa
tacgattccatcttcatggacatgaacatgccgctctcctcatactggatagcatcgtca
cacaacacctatctgacgggcgatcaattctccagcgaatcatcgtgcgaggcctatgcc
cgggccctgcgcatgggctgtcgctgcattgagctcgactgttggaatggccccgataac
ttaccctacatattccatggtcacacaatgacatccaaaatcaagttcatggatgttgta
aagaccatcaaggatcatgccttcaccacctccgagtatcccgtcattctgtccatcgaa
cagaattgctctttagagcagcaacgaaatatggcacaggcgttaattgaggtctttggc
gatatgctgctcacgcagccatgtgatcggaacgaacagcatttgccctccccctaccag
ctccgccgcaagataattctaaagcacaagaagctgccgcaatacgatgagacgacattc
agcggcgtgggcataagtaacggtggcatagcagccgccgctgctggtggcggcggcggc
tcatcgcttacccatcgatcatcgttgagcggtggcggtggcgaaaatgagggtgaaaat
atgcgcaaggtattcaaagaggggctgctgtacttcaaggatcccgtggacaagtcctgg
aatctctatcagtttgtgttgacccaacaagagctcatctacacctctgaaatcagtgaa
tcacatcggaatggaacctcagaagatgacgactttggtctgtcgtcgtcctgttctttg
aacaacacaatgcaacagaaacagaaggatacctcggccaacgatgagctgcattttggc
gaaaactggtttcatggcaaattggaaggtggccgcaaagaagccgacgacctgctgcaa
aagtataaacatcttggtgatggaacatttttggtgcgcgaatcggccacatttgtgggc
cgactatag

DBGET integrated database retrieval system