KEGG   Drosophila persimilis: Dper_GL15861Help
Entry
Dper_GL15861      CDS       T01063                                 

Definition
GL15861 gene product from transcript GL15861-RA
Orthology
K11252  
histone H2B
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 127 aa AA seqDB search
MPPKTASGNATKKAGKAQKNIHINTTDKKKRRKVRKESYAIYIYKVLKQVHPDTGVSSKA
MSIMNSFVNDIFERIASEASRLGHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgaaaactgcaagcgggaacgcaaccaagaaggctggaaaggcacagaagaac
atccacatcaacactaccgacaagaagaagaggcgcaaggtcaggaaggagagctatgcc
atctatatctacaaagttctgaagcaagtccacccggacactggtgtctcctccaaggcg
atgagcatcatgaacagctttgtaaacgatatcttcgagcgcattgcctcggaagcctct
cgtttgggtcactacaacaaaaagtccaccatcacaagtcgggaaatccaaacggctgtg
cggctacttctgccgggagagctggccaagcacgccgtcagtgagggaaccaaggccgtc
acgaagtacaccagctctaagtaa

DBGET integrated database retrieval system