KEGG   Drosophila persimilis: Dper_GL16108Help
Entry
Dper_GL16108      CDS       T01063                                 

Definition
GL16108 gene product from transcript GL16108-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dpe  Drosophila persimilis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dper_GL16108
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dper_GL16108
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dper_GL16108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 474 aa AA seqDB search
MVIVNTVNECIAGATKKLTSLGGQIKDIITIGITNQRESTVIWDRNTGQPLANAIIWLDN
RTTSTVEELLEAIPNNARNINYLRPLCGLPLSPYFSGVKLRWLRDNVPTVKAAMDSGVAM
FGTIDTWLMYNLTGGKNGGVHKTDVTNASRTMLMNIETLQWDPNLLKFFGLPKTILPEIC
SSAEFYGSLAQGVLKGTSITADLGDQQAALVGQQCLSKGQAKATYGTGCFLLYNTGPSIV
HSQHGLLTTVGYQLGRKATPYYALEGSVSIAGAAFNWLRDNIGLIQNSGQIEAMAATVDN
SLDVYFVPAFNGLYAPYWNQDARGVICGLSEETTSEHIVRATLEAVCFQVRDILDSMHKD
CKIPLAKLMVDGGMTVNNLFLQLQSDLVGIHVLRAKIAETTALGAAMAAYKAVENRYSME
APLSKSGPREPVKPTIGSTERNLRYQKWKMAIDRSLNWETSTLPQGEREAFDGA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggttatagtgaacaccgttaacgagtgcatcgcaggagctaccaagaagcttacctct
ctcggtggacaaatcaaggatatcatcacgattggaataacgaaccagcgggagtctacc
gtaatttgggaccggaacacaggccaacccttggctaacgctataatatggctggacaat
cgcactacgagtacagtagaggagctcctggaggccattcccaacaatgccagaaatatc
aactacctgcgccccctctgtggattgccgctctctccgtacttctcgggagtaaagctg
cgttggctacgggacaatgtcccgacggtcaaggcggcaatggacagtggagtggcaatg
tttggaaccatcgacacttggctgatgtataacctaacgggtggcaagaatggcggtgtc
cacaagacggacgtgaccaacgcttcgcgaacgatgctgatgaatattgaaacccttcag
tgggatcccaatctgctgaaattctttgggctacccaagaccatcttgccagagatttgt
tccagcgcagagttttatggcagcttagcgcagggcgttctcaaggggacaagtataact
gcggacttgggggatcagcaagcagcgctcgtcggacaacagtgtctttctaaaggtcag
gccaaggccacgtatggcactggttgctttctgctctataacacgggaccgtccattgtg
cactcccagcacggactgctaacgacagtgggctatcaattgggacggaaggccactccg
tactacgctttggaagggagtgtgtccatagctggagctgcttttaattggctgcgcgac
aacattggtcttattcaaaactccgggcagatcgaggctatggctgccacagtggataac
tctttggatgtctactttgtgccggcctttaacggattgtacgctccttactggaatcaa
gatgccaggggcgtcatatgtgggttgagtgaggagaccaccagtgaacatattgtccgc
gccacactggaggcggtctgctttcaggtccgcgatattctcgactctatgcacaaggat
tgcaagatcccactggccaagctgatggtcgatgggggcatgacggttaacaacctgttc
ctgcagctgcagtcggatttagtcggaattcatgtgcttagggccaagatagcagagaca
acagcgctgggcgcagcaatggcagcgtacaaggctgtcgagaatcggtattccatggag
gctcccctttccaaatcaggacccagggaacctgtcaagccgacgataggttctactgaa
cgcaatcttcgctaccaaaaatggaaaatggccattgatcgatccctgaactgggagacc
tccactctgccccagggcgagcgtgaggcttttgatggagcgtaa

DBGET integrated database retrieval system