KEGG   Drosophila persimilis: Dper_GL16141Help
Entry
Dper_GL16141      CDS       T01063                                 

Definition
GL16141 gene product from transcript GL16141-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dpe  Drosophila persimilis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dper_GL16141
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dper_GL16141
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dper_GL16141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 238 aa AA seqDB search
MSLRQFQTISQQVFRCLSTRAATSRRILGPVIELSQSQRQNLKFCTVLLPVSCAAAVSAP
QYSTAAAIDMSANGDYKNAASIYEFTVKDTHGSEVSLDKYKGRVLLVVNIASKCGLTKNN
YQKLTELKEKFGERGLTILNFPCNQFNSQMPEADGEAMVCHLRDAKADIGEIFARVDVNG
DNAAPVYKYLKAKQSGTLGSGLKWNFTKFLVNKEGIPINRYAPTTDPMDIAKDIEKLL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcaggcagtttcagaccatttcgcagcaggttttcaggtgcttatcgactcgg
gccgcaacaagtcgaagaatccttgggccggtcatcgaactgagtcagagtcaaaggcag
aatctaaagttctgcacggtcctcctgccagtcagctgtgcggcagccgtcagtgccccc
cagtactccacagcagctgccatcgacatgtctgccaacggagattacaagaacgccgct
tctatctatgagttcaccgtaaaggacacccatggaagtgaagtgtcgctggacaaatac
aagggccgagtacttctggtagttaatatcgcttccaagtgcggactgactaagaacaac
tatcagaagttgaccgaattgaaggagaagttcggcgagcgtggactcaccattttgaac
ttcccctgcaatcagttcaactcccaaatgccggaggccgacggcgaggcaatggtctgt
catctgcgcgatgccaaggctgacattggagaaatctttgccagggtggatgtcaatggc
gataacgctgctccggtctacaagtacttgaaggccaaacagtctggcactttgggcagt
ggtctcaagtggaactttacaaagttcctggtcaacaaagagggaatcccaatcaatcgt
tatgccccaaccaccgatcctatggacattgccaaggatattgagaaactattgtag

DBGET integrated database retrieval system